DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and Grtp1

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001355787.1 Gene:Grtp1 / 66790 MGIID:1914040 Length:359 Species:Mus musculus


Alignment Length:307 Identity:71/307 - (23%)
Similarity:118/307 - (38%) Gaps:75/307 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   869 VIITKASVDITNWERSPKAAEGDQMS-----------PLEEQAG---ESGGAGVNMDALQQPKSA 919
            ||:||.::   .|.:..|...|.:.|           |||.:|.   ...||...||  |.|   
Mouse    42 VILTKRAI---KWSKLLKGNGGVRKSVTVKRYVRKGIPLEHRARVWMAVSGAQARMD--QSP--- 98

  Fly   920 CASPASSNGGVY--------SSELLEQFGLNLHRIEKDVQRCDRNYWY--FANENLDK-LRNVIS 973
                     |.|        ||.|.|....:|:|...|      |..:  .|:..|.| |.||:.
Mouse    99 ---------GYYHRLLEGESSSSLDEAIRTDLNRTFPD------NVMFRKTADPCLQKTLYNVLL 148

  Fly   974 TYVWEHLDVGYMQ-----------------GMCDLVAPLLVIFDDESLSYSCFCKLMERMIENFP 1021
            .|...:.||||.|                 ||..:...|::|..:|..|:.....|:.|::.::.
Mouse   149 AYGLHNPDVGYCQCCAQKPGSSAGLRSSLTGMNFIAGYLILITKNEEESFWLLDALVGRILPDYY 213

  Fly  1022 SGGAMDMHFAN--MRSLIQILDSEMYDLMDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVI 1084
            |...:.:....  :..|:::....:..|||.:| ........|||:..|...|..:.|...|:.:
Mouse   214 SPAMLGLKTDQEVLAELVRMKLPAVAALMDGHG-VLWTLLVSRWFICLFVDILPVETVLRIWDCL 277

  Fly  1085 WAAKHIASGHFVLF-LALALLETYRDIILSNSMDFTDVIKFFNEMAE 1130
            :     ..|..::| :||.|::.:::.||..| ...|:...|.::.:
Mouse   278 F-----NEGSKIIFRVALTLIKQHQEFILEAS-SIPDICDKFKQITK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 43/193 (22%)
Grtp1NP_001355787.1 TBC 71..301 CDD:214540 58/255 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.