DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and TBC1D15

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:XP_006719627.1 Gene:TBC1D15 / 64786 HGNCID:25694 Length:699 Species:Homo sapiens


Alignment Length:467 Identity:112/467 - (23%)
Similarity:194/467 - (41%) Gaps:113/467 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   752 RAMKTSTDSGHVDESF-NELDEPDEEDNKQKQQQDEKISESESKLPDYRKL------EEQINQEP 809
            |.:..:..:..:.:|| |.||||             .....::.|.|.|||      .::|.::|
Human   199 RTLLVNCQNKSLSQSFENLLDEP-------------AYGLIQAGLLDRRKLLWAIHHWKKIKKDP 250

  Fly   810 ------SCSASTASSYETVGPGE--VHQRPNSDTRSVLSPEYLSADDLQLPDDED---------- 856
                  ..|..|...::::...:  .||||.|:....||.   :...|::...|:          
Human   251 YTATMIGFSKVTNYIFDSLRGSDPSTHQRPPSEMADFLSD---AIPGLKINQQEEPGFEVITRID 312

  Fly   857 -AVRPPPPPAAAAVIITKASVDITNWERSPKAAEGDQMSPLEEQAGESGGAGVNMDALQQ----- 915
             ..||        |:..:..|.:..|.::.                :|.|..:|:|.::|     
Human   313 LGERP--------VVQRREPVSLEEWTKNI----------------DSEGRILNVDNMKQMIFRG 353

  Fly   916 ------PKSACA---------SPASSNGGVYSSELLEQFGLNLH--------------------R 945
                  .|.|..         |.......:...:..|.|.:.|.                    .
Human   354 GLSHALRKQAWKFLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSISQEQEKRNSRLRDYRSL 418

  Fly   946 IEKDVQRCDR-NYWYFANEN--LDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDDESLSYS 1007
            |||||.|.|| |.:|...:|  |..|.:::.||.....|:||:|||.||::|||.:.::|..::.
Human   419 IEKDVNRTDRTNKFYEGQDNPGLILLHDILMTYCMYDFDLGYVQGMSDLLSPLLYVMENEVDAFW 483

  Fly  1008 CFCKLMERMIENFPSG-GAMDMHFANMRSLIQILDSEMYDLMDSNGDYTHFYFCYRWFLLDFKRE 1071
            ||...|::|.:||... ..|......:.:|:::|||.....::|. |..:.|||:||.|:.||||
Human   484 CFASYMDQMHQNFEEQMQGMKTQLIQLSTLLRLLDSGFCSYLESQ-DSGYLYFCFRWLLIRFKRE 547

  Fly  1072 LVYDDVFATWEVIWAAKHIASGHFVLFLALALLETYRDIILSNSMDFTDVIKFFNEMAERHNAQS 1136
            ..:.|:...|||:|.  .:...:|.|.|..|:||:.:..|:.....|.:::|..||::.:.:.:.
Human   548 FSFLDILRLWEVMWT--ELPCTNFHLLLCCAILESEKQQIMEKHYGFNEILKHINELSMKIDVED 610

  Fly  1137 VLQLARSLVLQL 1148
            :|..|.::.||:
Human   611 ILCKAEAISLQM 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 58/187 (31%)
TBC1D15XP_006719627.1 DUF3548 19..227 CDD:192931 8/40 (20%)
TBC 351..586 CDD:214540 67/237 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.