DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and usp6nl

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:XP_005164934.1 Gene:usp6nl / 561983 ZFINID:ZDB-GENE-041210-192 Length:849 Species:Danio rerio


Alignment Length:195 Identity:45/195 - (23%)
Similarity:87/195 - (44%) Gaps:24/195 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   942 NLHRIEKDVQRCDRNYWYFANE---NLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDDES 1003
            ::.:|:.||.|..||:..|.:.   ....|.:|::.|...:.:|||.|||..:.| ||:|:.:|.
Zfish   163 DVRQIDLDVNRTYRNHIMFMHRYDVKQQDLFHVLTAYSVYNTEVGYCQGMSQITA-LLLIYMNEE 226

  Fly  1004 LSYSCFCKLMER--------MIENFPSGGAMDMHFANMRSLIQILDSEMYDLMDSNGDYTHFYFC 1060
            .::....||:..        .:..||.......|...   ::|.:..::...:|:...||..| .
Zfish   227 DAFWALVKLLSGQRHTMHGFFVPGFPKLMRFQEHHDR---ILQKMMPKLKQHLDNQEVYTSLY-T 287

  Fly  1061 YRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVL-FLALALLETYRDIILSNSMDFTDVIKF 1124
            .:||...|.....:......|::     :|..|..|| .::..:|:.::..:|..||:  :::||
Zfish   288 MKWFFQCFLDRTPFTLTLRIWDI-----YILEGERVLTAMSYTILKLHKKTLLKLSME--ELVKF 345

  Fly  1125  1124
            Zfish   346  345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 35/155 (23%)
usp6nlXP_005164934.1 TBC 120..326 CDD:214540 39/172 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.