DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and Tbc1d13

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:XP_575106.2 Gene:Tbc1d13 / 499768 RGDID:1591937 Length:400 Species:Rattus norvegicus


Alignment Length:381 Identity:79/381 - (20%)
Similarity:139/381 - (36%) Gaps:100/381 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   801 LEEQINQEPSCSASTASSYETVGPGEVHQRPNSDTRSVLSPEYLSADDLQLPDDEDAVRPPPPPA 865
            |.|.|.|.....|:...|.|.|...:....||.|:|   ...|...:::.|..|:|..|..|   
  Rat    74 LREMIIQPGIAKANMGVSREDVTFEDHPLNPNPDSR---WNTYFKDNEVLLQIDKDVRRLCP--- 132

  Fly   866 AAAVIITKASVDITNWERSPK---------------AAEGDQMSPLEEQAGESGGAGV-NMDALQ 914
                       ||:.::|:.:               ..:..:.:.|:.|......:|| ||    
  Rat   133 -----------DISFFQRATEYPCLLILDPQNEFETLRKRVEQTTLKSQTVARNRSGVTNM---- 182

  Fly   915 QPKSACASPASSNGGVYSSELLEQFGLNLHRIEKDVQRCDRNYWYFANENLDKLRNVISTYVWEH 979
                  :||..:|.         ...||.:.:..:  .|:. :|       :.:..::..|...:
  Rat   183 ------SSPHKNNA---------PSALNEYEVLPN--GCEA-HW-------EVVERILFIYAKLN 222

  Fly   980 LDVGYMQGMCDLVAPLLVIF----------DDESLSYSCFCKLMERMIENF-----PSGGAMDMH 1029
            ..:.|:|||.::|.||...|          ..|:.::.||..||..:.:||     .|...:...
  Rat   223 PGIAYVQGMNEIVGPLYYTFATDPNSEWKEHAEADTFFCFTNLMAEIRDNFIKSLDDSQCGITYK 287

  Fly  1030 FANMRSLIQILDSEMYDLMDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGH 1094
            ...:.|.::..|.|:|..:........| |.:||..|...:|.:..||...|:.::     |.|:
  Rat   288 MEKVYSTLKEKDVELYLKLQEQSIKPQF-FAFRWLTLLLSQEFLLPDVIRIWDSLF-----ADGN 346

  Fly  1095 ---FVLFLALALLETYRDIILSNSMDFT------------DVIKFFNEMAERHNAQ 1135
               |:|.:..|:|...|:.:|..  |||            ||.|...:..|..:::
  Rat   347 RFDFLLLVCCAMLILIREQLLKG--DFTVNMRLLQDYPISDVCKILQKAKELQDSK 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 36/178 (20%)
Tbc1d13XP_575106.2 TBC 32..367 CDD:214540 71/344 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.