DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and CG5916

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster


Alignment Length:247 Identity:55/247 - (22%)
Similarity:102/247 - (41%) Gaps:54/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   931 YSSELLEQFGLNLHRIEKDVQRCDRNYWYFANENLD----KLRNVISTYVWEHLDVGYMQGMCDL 991
            :..|:.:...::|.|...|            |.:.|    :|.|::..|...:.||||.||:..:
  Fly   106 FDKEISDSISIDLPRTFPD------------NIHFDMKKQRLYNILIAYAHHNRDVGYCQGLNYI 158

  Fly   992 VAPLLVIFDDESLSYSCFCKLMERMIENFPSGGAMDMHFANMRSLIQILDSEMYDL--------- 1047
            ...||::.|||..|:    .|::.::||.    ....|..||.:|::.| :...:|         
  Fly   159 AGLLLIVTDDEEKSF----WLLKHIVENI----VPQYHSHNMANLLRDL-AVFRELVIRRIPAVN 214

  Fly  1048 --MDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLF-LALALLETYRD 1109
              :|:.| ..:.....:||:..|...|..:.|...|:.::     |.|:.::| .||.:..|:::
  Fly   215 RHVDNLG-LPYPVIASKWFICIFAEVLPVETVLRIWDCVF-----AEGYKIVFRAALTMFVTHKN 273

  Fly  1110 IILSNSMDFTDVIKFFNEMAERHN----------AQSVLQLARSLVLQLQMI 1151
            .||... |...:...|.:...:.|          |...|:|.||.:..|:.:
  Fly   274 AILGCD-DIAALANLFRDTMIQDNIVTDCHGFVEAMFSLRLKRSELESLRKV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 38/170 (22%)
CG5916NP_001287357.1 TBC 67..276 CDD:214540 44/196 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456615
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.