DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and TBC1D5

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_731780.1 Gene:TBC1D5 / 41628 FlyBaseID:FBgn0038129 Length:654 Species:Drosophila melanogaster


Alignment Length:313 Identity:65/313 - (20%)
Similarity:119/313 - (38%) Gaps:105/313 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   931 YSSELLEQ----------FGLNLHRIEKD-----VQRCDRNYW--YFANENL------DKLR--- 969
            ::|:.|:|          :..|.|::..|     :.:..::.|  ||::::|      |.:|   
  Fly    95 WTSQRLQQRVRYDKFRADYVRNPHQLAVDCNDDPLSQSTQSVWNQYFSDQDLFAVIRQDVVRTFP 159

  Fly   970 ---------------NVISTYVWEHLDVGYMQGMCDLVAPLL-VIFDD----------------- 1001
                           |::..|..||..:.|.|||.:::||:: |::.|                 
  Fly   160 GVDFFRKPLVQNAMVNILFYYAREHPYMCYRQGMHEILAPIIFVVYSDHQSLLHFSELAKTDINP 224

  Fly  1002 -----------ESLSYSCFCKLMERM-----IENFPS--GGAM--------DMHFANMRSLIQIL 1040
                       |:.:||.|.:||..:     :.|..|  ||.:        |...:....:|..|
  Fly   225 TLLDVLDPAYLEADTYSLFSRLMASVESYYRVSNLVSTPGGHIEQRAESPGDNETSTEAEVIGQL 289

  Fly  1041 DSEMYDLMDSNGDYTHFY----------FCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHF 1095
            :.....::.....:.|.|          |..||..|.|.||.:..|:...|:.|:|    .|..|
  Fly   290 NFIRDKILAKQDQHLHHYLQKMEIPLHIFGIRWLRLLFGREFMLLDLLLLWDAIFA----DSDRF 350

  Fly  1096 VL--FLALALLETYRDIILSNSMDFTDVIKFFNEMAERHNAQSVLQLARSLVL 1146
            .|  ::.:|:|...||.:|.:  |:|..:.:.  |...:|....|.|..:|.:
  Fly   351 DLPNYILVAMLVHIRDKLLLS--DYTTSLTYL--MRYPNNVDVHLVLRHALFM 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 49/250 (20%)
TBC1D5NP_731780.1 TBC <150..369 CDD:214540 47/222 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456535
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.