DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and sgsm3

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_998495.1 Gene:sgsm3 / 406635 ZFINID:ZDB-GENE-040426-2635 Length:755 Species:Danio rerio


Alignment Length:305 Identity:66/305 - (21%)
Similarity:117/305 - (38%) Gaps:82/305 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   877 DITNWER-SPKAAEGDQMSPLEEQAGESGGAGVNM---------DALQQPKSACAS-----PASS 926
            |:| |:: :|..|..|::..|     ..||...:|         .|||:.:::..|     ..||
Zfish    92 DLT-WDKITPTLARSDRLRSL-----VLGGIPHSMRPQLWMRLSGALQKKRTSDISYREIVKNSS 150

  Fly   927 NGGVYSSELLEQFGLNLHRIEKDVQR------CDRNYWYFANENLDKLRNVISTYVWEHLDVGYM 985
            |....:::          :||||:.|      |   :....:..:.|||.|:....|.:.|:||.
Zfish   151 NDDTTAAK----------QIEKDLLRTMPTNAC---FNTLTSVGVPKLRRVLRGLAWLYPDIGYC 202

  Fly   986 QGMCDLVAPLLVIFDDESLSYSCFCKLMERMIENFPSGGAMDMHFA--------NMRSLIQILDS 1042
            ||...:|:.||:..::|...: ..|.|:|.::.  ||      :|:        :.|.|.|::..
Zfish   203 QGTGMVVSCLLLFLEEEDALW-MMCALIEDLLP--PS------YFSSTLLGVQTDQRVLRQLIVQ 258

  Fly  1043 EM--YDLMDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLF-LALALL 1104
            .:  .|.:....|.........|||..|...:....:...|::::     ..|..||| :.|.:|
Zfish   259 YLPRLDKLLQEHDIELSLITLHWFLTAFASVVDIRILLRIWDLLF-----YEGSMVLFQVTLGML 318

  Fly  1105 ETYRDIILSNSMDFTDVIKFFNEMAERHNAQSVLQLARSLVLQLQ 1149
            :...|                 |:....|:.|:......|..||:
Zfish   319 KIKED-----------------ELVSSENSASIFNTLSDLPSQLE 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 39/179 (22%)
sgsm3NP_998495.1 TBC 112..326 CDD:214540 54/257 (21%)
SH3_SGSM3 488..540 CDD:212747
RUN 567..720 CDD:280855
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.