DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and CG8155

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_611029.3 Gene:CG8155 / 36698 FlyBaseID:FBgn0034009 Length:1098 Species:Drosophila melanogaster


Alignment Length:197 Identity:65/197 - (32%)
Similarity:99/197 - (50%) Gaps:14/197 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   904 GGA-GVNMDALQ-------QPKSACASPASSNGGVYSSELLEQFGLNLHRIEKDVQRCDRNYWYF 960
            ||| |:.:|..|       :.:..|....:....|....:..:.......::|||.|.||.:.::
  Fly   245 GGANGLALDGHQRMEFMRRKSEQYCRLRDTWKAAVKRGSVAGELAYVTSMVKKDVLRTDRLHPFY 309

  Fly   961 A----NENLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDDESLSYSCFCKLMERMIENFP 1021
            |    |:|:..|.|:::||...|..|.|.|||.|:.:||||..:||:.:|.|||.:|.||..||.
  Fly   310 AGSDDNQNIAALFNILTTYALNHPSVSYCQGMSDIASPLLVTMNDEAQAYICFCAIMSRMRGNFM 374

  Fly  1022 SGG-AMDMHFANMRSLIQILDSEMYDLMDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIW 1085
            ..| ||...||::...:...|.|.::.:.|. ......|||||.||:.|||..::|.....||.|
  Fly   375 LDGIAMTQKFAHLTEALSFYDPEFWEYLKSQ-QADDLLFCYRWLLLELKREFPFEDALRMLEVQW 438

  Fly  1086 AA 1087
            ::
  Fly   439 SS 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 58/168 (35%)
CG8155NP_611029.3 TBC 225..439 CDD:214540 64/194 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456617
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.