DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and Tbc1d10b

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001102391.1 Gene:Tbc1d10b / 365372 RGDID:1309191 Length:795 Species:Rattus norvegicus


Alignment Length:523 Identity:97/523 - (18%)
Similarity:157/523 - (30%) Gaps:181/523 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   720 PGDLEFDEQQQQQQQQAECAVSGN--HLTVKPIPRAMKTSTDSGHVDESFNE--------LDEPD 774
            ||.|       |.........:|:  .||::..|.|.||........|:..|        .|.|.
  Rat    64 PGSL-------QTSASTPTTATGSTVELTLEASPEAAKTQEFPAPAAEAGAETSVALVLGTDTPK 121

  Fly   775 EEDNKQKQQQDEKISESESKLPDYRKLEEQINQEPSCS---ASTASSYETV--GPGEVHQRPNSD 834
            .|:.:......   ..:.::.|. |.....:..:|..:   .:|.:|..|.  |.|:|.....:.
  Rat   122 TEEARASPVPG---PGTPTRTPS-RTASGALTAKPPLAPKPGTTVASGVTARGGAGQVAGGHGAA 182

  Fly   835 TRSVLSPEYLSADDLQLPDDEDAVRPPPP------PAAAAVIITKASVDITNWE----------- 882
            |.:...|         :|:|.......||      ...|.|.:|.|.....|::           
  Rat   183 TSASAGP---------VPEDPSGPVTGPPGTCEASAPVARVTVTPAPETTENFQDLGSTSSLGPG 238

  Fly   883 -RSPKAAEGDQMSPLEEQAGESGGAGVNMDALQQPKSACASPASSNG------------------ 928
             ..|:....|.:|.|:..:..||    .:::|....|:..|.:..||                  
  Rat   239 ISGPRGQAPDTLSYLDSVSLMSG----TLESLTDDVSSVGSDSEINGLALRKTDKYGFLGGSQYS 299

  Fly   929 -------------------------------------------GVYSS-------------ELLE 937
                                                       |:.||             ||||
  Rat   300 GSLESSIPVDVARQRELKWLEMFSNWDKWLSRRFQKVKLRCRKGIPSSLRAKAWQYLSNSKELLE 364

  Fly   938 QFGLN----------------LHRIEKDVQRCDRNYWYFA---NENLDKLRNVISTYVWEHLDVG 983
            |   |                |..||||:.|....:..||   ......|..::..|.....|.|
  Rat   365 Q---NPGKFEELERAPGDPKWLDVIEKDLHRQFPFHEMFAARGGHGQQDLYRILKAYTIYRPDEG 426

  Fly   984 YMQGMCDLVAPLLVIFDDESLSYSCFCKLMERMIENFPSGGAMDMHFANMRSLIQILDSEM-YDL 1047
            |.|....:.|.||:....|. ::.|..::.::.:..:.|.|.         ..|| ||.|: :.|
  Rat   427 YCQAQAPVAAVLLMHMPAEQ-AFWCLVQICDKYLPGYYSAGL---------EAIQ-LDGEIFFAL 480

  Fly  1048 MDSNGDYTHFY----------FCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLF-LAL 1101
            :.......|.:          :...||:..|.|.|.:..|...|::.:     ..|..::| :||
  Rat   481 LRRASPLAHRHLRRQRIDPVLYMTEWFMCIFARTLPWASVLRVWDMFF-----CEGVKIIFRVAL 540

  Fly  1102 ALL 1104
            .||
  Rat   541 VLL 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 46/267 (17%)
Tbc1d10bNP_001102391.1 TBC 340..545 CDD:214540 50/223 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.