DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and Tbc1d10a

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001015022.1 Gene:Tbc1d10a / 360968 RGDID:1311641 Length:505 Species:Rattus norvegicus


Alignment Length:324 Identity:58/324 - (17%)
Similarity:107/324 - (33%) Gaps:99/324 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   860 PPPPPAAAAVIITKASVDITNWERSPKAAEGDQMSPLEEQA-----------------GESGGAG 907
            |..|.:..::..|:.|:     .:.|.||..|::|.|...:                 |..|..|
  Rat    10 PRAPASGGSLSGTRESL-----AQGPDAATADELSSLGSDSEANGFAERRIDKFGFIVGSQGAEG 69

  Fly   908 ----VNMDALQQPKS----------------------ACAS--PASSNGGVY------------S 932
                |.::.|:|.:|                      .|..  |.|..|..:            :
  Rat    70 ALEEVPLEVLRQRESKWLDMLNNWDKWMAKKHKKIRLRCQKGIPPSLRGRAWQYLSGGKVKLQQN 134

  Fly   933 SELLEQFGLN------LHRIEKDVQRCDRNYWYFAN---ENLDKLRNVISTYVWEHLDVGYMQGM 988
            ....::..::      |..||:|:.|....:..|.:   .....|..|:..|.....:.||.|..
  Rat   135 PGKFDELDMSPGDPKWLDVIERDLHRQFPFHEMFVSRGGHGQQDLFRVLKAYTLYRPEEGYCQAQ 199

  Fly   989 CDLVAPLLVIFDDESLSYSCFCKLMERMIENFPSGGAMDMHFANMRSLIQILDSE-MYDLMDSNG 1052
            ..:.|.||:....|. ::.|..::.|:.:..:         ::.....|| ||.| ::.|:....
  Rat   200 APIAAVLLMHMPAEQ-AFWCLVQVCEKYLPGY---------YSEKLEAIQ-LDGEILFSLLQKVS 253

  Fly  1053 DYTH----------FYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLF-LALALLE 1105
            ...|          ..:...||:..|.|.|.:..|...|::.:     ..|..::| :.|.||:
  Rat   254 PVAHKHLSRQKIDPLLYMTEWFMCAFARTLPWSSVLRVWDMFF-----CEGVKIIFRVGLVLLK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 35/195 (18%)
Tbc1d10aNP_001015022.1 TBC 110..313 CDD:214540 40/219 (18%)
VCX_VCY 404..>501 CDD:291884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.