DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and Tbc1d14

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001106836.1 Gene:Tbc1d14 / 360956 RGDID:1309993 Length:714 Species:Rattus norvegicus


Alignment Length:436 Identity:89/436 - (20%)
Similarity:153/436 - (35%) Gaps:129/436 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   764 DESFNELDEPDEEDNKQKQQQDEKISESESK-LPDYRKLEEQINQEPSCSASTASSYETVGPGEV 827
            |...|...:|.||..|.:||.:|.:.:::.: |.:.::.::|:  |..|...     |::|..  
  Rat   339 DRPANLPAKPAEEAQKHRQQYEEMVVQAKKRELKEAQRRKKQL--EERCKVE-----ESIGNA-- 394

  Fly   828 HQRPNSDTRSVLSPEYLSADDLQLPDDEDAVRPPPPPAAAAVIITKASVDITNWERSPKAAEGDQ 892
                           .|:.::..||:.|            .:..:|...|:. |:..|.:..|..
  Rat   395 ---------------VLTWNNEILPNWE------------TMWCSKKVRDLW-WQGIPPSVRGKV 431

  Fly   893 MSPLEEQAGESGGAGVNMDALQQPKSACASPAS------SNGGVYSSEL-LEQFGL-------NL 943
            .|.         ..|..::...:....|.:.|.      |.||   ||: .|..|.       :|
  Rat   432 WSL---------AIGNELNITHELFDICLARAKERWRSLSTGG---SEVENEDAGFSAADREASL 484

  Fly   944 HRIEKDVQRCDRNYWYF--ANENLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDDESLSY 1006
            ..|:.|:.|...|...|  .....|.|.:::..|.....||||:||| ..:|.:|::..|.:.::
  Rat   485 ELIKLDISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGM-SFIAAVLILNLDTADAF 548

  Fly  1007 SCFCKLMER-------------MI-----------ENFPSGGAMDMHFA--NMRSLIQILDSEMY 1045
            ..|..|:.:             |:           ||.|.   :..||.  |:.:.|.::|    
  Rat   549 IAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPK---LFAHFKKNNLTADIYLID---- 606

  Fly  1046 DLMDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLF-LALALLETYRD 1109
                             |....:.:.|..|.....|:|.     ...|...|| .||.:|:.:.|
  Rat   607 -----------------WIFTLYSKSLPLDLACRIWDVF-----CRDGEEFLFRTALGILKLFED 649

  Fly  1110 IILSNSMDFTDVIKFFNEMAERHNAQSVLQLARSLVLQLQMIIENK 1155
            |:  ..|||....:|...:.|...|..|.    :.:..:||...||
  Rat   650 IL--TRMDFIHSAQFLTRLPEDLPADDVF----AAISTVQMQSRNK 689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 43/205 (21%)
Tbc1d14NP_001106836.1 DUF4207 147..384 CDD:290615 12/46 (26%)
TBC 419..651 CDD:214540 56/274 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.