DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and CG3703

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_569874.1 Gene:CG3703 / 31045 FlyBaseID:FBgn0040348 Length:711 Species:Drosophila melanogaster


Alignment Length:478 Identity:87/478 - (18%)
Similarity:151/478 - (31%) Gaps:169/478 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ERLIASVKKEVKQLMEEAV-TKKYVHEESSSVTSLCGAVEACLSQGLRRRALGLFKTSSTTALLH 76
            :.|.|.:..:|:|....|: |::..|:..:::....|.::      ::.:.:...||..|     
  Fly   212 DELRAKLNLQVEQHELPALSTEQLRHQVDNAIGEFVGPLK------MKEQLVAQLKTQIT----- 265

  Fly    77 KIAKSCPEAEHISKLVQ--EIEAS--DPSKRSSSSSDSFQRPPMLKKSSSNSMSTGTNAAASTSS 137
                   :.|.....:|  .||.|  |..|..|.:.:|:......:  ||.:....|||.|:|::
  Fly   266 -------DLERFIAFLQCDAIEGSVGDRLKLLSGAYNSYAAKQTAR--SSQASYVATNAPATTAT 321

  Fly   138 ASASISVSASTSSMSLASMKYLWIRLALYEKRLTKIIEYLVSNASSFYDRDSLVADSDYGSILSS 202
            ...|..:.|.:|.                        |.|.|.|....|:.|::..    ...|:
  Fly   322 TPPSSGLGAHSSG------------------------ESLHSKAHGLLDKASVLMQ----MFAST 358

  Fly   203 LLVGPCALEFTRAKTAD-------------HYWTDPHADELVQRHRISSCRRSSSTCSRPAIINF 254
            .||.|        :|.|             ::|.|..|...|....:::...:.| |.|..:.|.
  Fly   359 HLVKP--------RTHDEFQQNSLKKTHKGNHWGDLRAQLEVDIQEVAALAATLS-CDREKLANI 414

  Fly   255 KRSLNTSSDEAGTGSFKSIASASVAKDYVESLHQNAKATLLYGKNNVQVLPKDVAEPMPGYLSLH 319
            ||:|.....:|.:..|....:                 .::..:|....||......:|      
  Fly   415 KRALRKQQQQAESTEFSDTGN-----------------PVINSQNGALTLPPRCRRAVP------ 456

  Fly   320 QHIQTLTIKWTPNQL----MNGYTEAEEAEDIDKDAF-WAYALNINVDEIVYVHCHQSRGEDS-- 377
                      |.::|    ..|...::..|||....| |.               .:|:...:  
  Fly   457 ----------TGHELAPYASGGAISSDSDEDISYSNFEWE---------------KESKSRRTTH 496

  Fly   378 --GGTVILVG-------------------QDGVQRPPIHFPEGGHMQQFLSCLETGLLPHGQLDP 421
              |.::..:|                   |.|: |.|........|..|:.||..|        |
  Fly   497 ARGDSIATIGRELTTVVRKNFARTLQQLIQHGL-RIPAESAASSLMVPFMRCLHPG--------P 552

  Fly   422 PLW-------SQ-RGIGK-MFLW 435
            |:.       || .|:|: |..|
  Fly   553 PVVPPAVGGDSQFLGLGRAMHAW 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855 33/176 (19%)
PH_RUTBC 292..466 CDD:275431 32/181 (18%)
TBC 923..1087 CDD:214540
CG3703NP_569874.1 RUN 516..703 CDD:280855 17/69 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.