DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and TBC1D10B

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_056342.3 Gene:TBC1D10B / 26000 HGNCID:24510 Length:808 Species:Homo sapiens


Alignment Length:366 Identity:75/366 - (20%)
Similarity:123/366 - (33%) Gaps:112/366 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   808 EPSCSASTASSYETVGPGEVHQRPNS-DTRSVLSPEYLSADDLQ-LPDDEDAVRPPPPPAAAAV- 869
            ||:.::....|..::|||....|..: ||.|.|....|.:..|: |.||..::.........|: 
Human   238 EPAENSQDLGSTSSLGPGISGPRGQAPDTLSYLDSVSLMSGTLESLADDVSSMGSDSEINGLALR 302

  Fly   870 ----------------IITKASVDI------------TNWERSPKAAEGDQMSPLEEQAGESGGA 906
                            :.:...||:            :||::.           |..:       
Human   303 KTDKYGFLGGSQYSGSLESSIPVDVARQRELKWLDMFSNWDKW-----------LSRR------- 349

  Fly   907 GVNMDALQQPKSACAS--PASSNGGVY-----SSELLEQFGLN----------------LHRIEK 948
                  .|:.|..|..  |:|.....:     |.|||||   |                |..|||
Human   350 ------FQKVKLRCRKGIPSSLRAKAWQYLSNSKELLEQ---NPGKFEELERAPGDPKWLDVIEK 405

  Fly   949 DVQRCDRNYWYFA---NENLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDDESLSYSCFC 1010
            |:.|....:..||   ......|..::..|.....|.||.|....:.|.||:....|. ::.|..
Human   406 DLHRQFPFHEMFAARGGHGQQDLYRILKAYTIYRPDEGYCQAQAPVAAVLLMHMPAEQ-AFWCLV 469

  Fly  1011 KLMERMIENFPSGGAMDMHFANMRSLIQILDSEM-YDLMDSNGDYTHFY----------FCYRWF 1064
            ::.::.:..:.|.|.         ..|| ||.|: :.|:.......|.:          :...||
Human   470 QICDKYLPGYYSAGL---------EAIQ-LDGEIFFALLRRASPLAHRHLRRQRIDPVLYMTEWF 524

  Fly  1065 LLDFKRELVYDDVFATWEVIWAAKHIASGHFVLF-LALALL 1104
            :..|.|.|.:..|...|::.:     ..|..::| :||.||
Human   525 MCIFARTLPWASVLRVWDMFF-----CEGVKIIFRVALVLL 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 44/198 (22%)
TBC1D10BNP_056342.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..225
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..264 7/25 (28%)
TBC 357..562 CDD:214540 51/223 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 629..808
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.