DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and TBC1D12

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_056003.1 Gene:TBC1D12 / 23232 HGNCID:29082 Length:775 Species:Homo sapiens


Alignment Length:462 Identity:95/462 - (20%)
Similarity:169/462 - (36%) Gaps:127/462 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   733 QQQAECAVSGNHLTVKPIPRAMKTSTDSGHVDESFNEL--------DEPD-------EEDNKQKQ 782
            ||:.| |.:|.  |.||.|::      |...:..|..|        |.|.       ||..:.:|
Human   364 QQEYE-ARTGR--TCKPPPQS------SRRKNFEFEPLSTTALILEDRPSNLPAKSVEEALRHRQ 419

  Fly   783 QQDEKISES---ESKLPDYRK--LEEQINQEPSCSASTASSYETVGPG-EVHQRPNSDTRSVLSP 841
            :.||.::|:   |.|....||  ::|:..||.:.:::.......:.|. ||.:    .||.|...
Human   420 EYDEMVAEAKKREIKEAHKRKRIMKERFKQEENIASAMVIWINEILPNWEVMR----STRRVREL 480

  Fly   842 EYLSADDLQLPDDEDAVRPPPPPAAAAVIITKA---SVDITNWERSPKAAE------GDQMSPLE 897
            .:...                ||:....:.:.|   .::||     |:..|      .::.....
Human   481 WWQGL----------------PPSVRGKVWSLAVGNELNIT-----PELYEIFLSRAKERWKSFS 524

  Fly   898 EQAGESGGAGVNMDALQQPKSACASPASSNGGVYSSELLEQFGLNLHRIEKDVQRCDRNYWYF-- 960
            |.:.|:...||::          |...:|                |..|:.|:.|...:.:.|  
Human   525 ETSSENDTEGVSV----------ADREAS----------------LELIKLDISRTFPSLYIFQK 563

  Fly   961 ANENLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDDESLSYSCFCKLMER---------- 1015
            .....|.|.:::..|.....||||:||| ..:|.:|::..:|:.::..|..|:.:          
Human   564 GGPYHDVLHSILGAYTCYRPDVGYVQGM-SFIAAVLILNLEEADAFIAFANLLNKPCQLAFFRVD 627

  Fly  1016 ---MIENFPSGGAMDMHF-ANMRSLIQILDSEMYDLMDSNGDYTHFYFCYRWFLLDFKRELVYDD 1076
               |::.|   ...::.| .|:..|  .|..:.|.|       |...:...|....:.:.|..|.
Human   628 HSMMLKYF---ATFEVFFEENLSKL--FLHFKSYSL-------TPDIYLIDWIFTLYSKSLPLDL 680

  Fly  1077 VFATWEVIWAAKHIASGHFVLF-LALALLETYRDIILSNSMDFTDVIKFFNEMAERHNAQSVLQL 1140
            ....|:|.     ...|...|| ..|.:|..|.||:|  .|||..:.:|..::.|...::.:...
Human   681 ACRVWDVF-----CRDGEEFLFRTGLGILRLYEDILL--QMDFIHIAQFLTKLPEDITSEKLFSC 738

  Fly  1141 ARSLVLQ 1147
            ..::.:|
Human   739 IAAIQMQ 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 35/179 (20%)
TBC1D12NP_056003.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..312
TBC 481..712 CDD:214540 55/295 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.