DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and Tbc1d12

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_666064.3 Gene:Tbc1d12 / 209478 MGIID:2384803 Length:698 Species:Mus musculus


Alignment Length:406 Identity:74/406 - (18%)
Similarity:144/406 - (35%) Gaps:105/406 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   775 EEDNKQKQQQDEKISES---ESKLPDYRK--LEEQINQEPSCSASTASSYETVGPGEVHQRPNSD 834
            ||..:.:|:.||.::|:   |.|....||  ::|:..||.|.:::.......:.|.....|....
Mouse   335 EEALRHRQEYDEMVAEAKKREIKEAHKRKRIMKERFKQEESIASAMVIWINEILPNWEVMRSTRR 399

  Fly   835 TRSV----LSPEYLS-------ADDLQLPDDEDAVRPPPPPAAAAVIITKASVDITNWERSPKAA 888
            .|.:    |.|....       .::|.:           .|....:.:::|.....::..|....
Mouse   400 VRELWWQGLPPSVRGKVWSLAVGNELNI-----------TPELYEIFLSRAKERWKSFSESSSEN 453

  Fly   889 EGDQMSPLEEQAGESGGAGVNMDALQQPKSACASPASSNGGVYSSELLEQFGLNLHRIEKDVQRC 953
            :.:.:|..:.:|                                         :|..|:.|:.|.
Mouse   454 DTEGLSVADREA-----------------------------------------SLELIKLDISRT 477

  Fly   954 DRNYWYF--ANENLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDDESLSYSCFCKLMER- 1015
            ..:.:.|  .....|.|.:::..|.....||||:||| ..:|.:|::..:|:.::..|..|:.: 
Mouse   478 FPSLYIFQKGGPYHDVLHSILGAYTCYRPDVGYVQGM-SFIAAVLILNLEEADAFIAFANLLNKP 541

  Fly  1016 ------------MIENFPSGGAMDMHF-ANMRSLIQILDSEMYDLMDSNGDYTHFYFCYRWFLLD 1067
                        |::.|   ...::.| .|:..|  .|..:.|:|       |...:...|....
Mouse   542 CQLAFFRVDHSMMLKYF---ATFEVFFEENLSKL--FLHFKSYNL-------TPDIYLIDWIFTL 594

  Fly  1068 FKRELVYDDVFATWEVIWAAKHIASGHFVLF-LALALLETYRDIILSNSMDFTDVIKFFNEMAER 1131
            :.:.|..|.....|:|.     ...|...|| ..|.:|..|.||:|  .|||..:.:|..::.|.
Mouse   595 YSKSLPLDLACRVWDVF-----CRDGEEFLFRTGLGILRLYEDILL--QMDFIHIAQFLTKLPED 652

  Fly  1132 HNAQSVLQLARSLVLQ 1147
            ..::.:.....::.:|
Mouse   653 ITSEKLFSCIAAIQMQ 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 34/179 (19%)
Tbc1d12NP_666064.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..236
COG5210 304..639 CDD:227535 69/375 (18%)
RabGAP-TBC 468..635 CDD:278964 41/184 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.