DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and TBC1D3E

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001278395.1 Gene:TBC1D3E / 102723859 HGNCID:27071 Length:549 Species:Homo sapiens


Alignment Length:503 Identity:100/503 - (19%)
Similarity:163/503 - (32%) Gaps:168/503 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 LSIDQFPMESP---LILQQQQQQQQQLLQAQSTSIEMVCSTMRRQIISRAFYGW----------- 556
            |:.::..:::|   .|::::.::..:.:|.....   |..|:|:.|..|..||.           
Human   115 LNTEEMKLKNPGRYQIMKEKGKKSSEHIQRIDRD---VSGTLRKHIFFRDRYGTKQRELLHILLA 176

  Fly   557 -------LAYCRHLSTVRTHLSGLVHGRITPEMKADEEGLTKERWQLLNVNGVLENATEFYRLVY 614
                   :.|||.||    |::.|.. ...||..|        .|.|:.:     .|:|.:.|..
Human   177 YEEYNPEVGYCRDLS----HIAALFL-LYLPEEDA--------FWALVQL-----LASERHSLQG 223

  Fly   615 FGGVQPELRQEVWPYLLGHYAFGSTTEDRKKQDETCKHYYETTMSEWLAVDAIVQQREKEKTARA 679
            |                 |...|.|.:..:.|.|   |...|:..:.:.     .|.:|:...:.
Human   224 F-----------------HSPNGGTVQGLQDQQE---HVVATSQPKTMG-----HQDKKDLCGQC 263

  Fly   680 ------VAKLSSGSNSGNDRTVRAADLEAGGDLENEVFEDISDISDPGDLEFDEQQQQQQQQAEC 738
                  :..|..|.:.|  .|:|..|:..   :|.|  :.:..|:   .:.|..||::..:.:.|
Human   264 SPLGCLIRILIDGISLG--LTLRLWDVYL---VEGE--QALMPIT---RIAFKVQQKRLTKTSRC 318

  Fly   739 AVSGNHLTVKPIPRAMKTSTDSGHVDESFNELDEPDEEDNKQKQQQDEKISESESKLPDYRKLEE 803
            .         |..|......|:...||         :...|..:...:|::..:..||...|.|:
Human   319 G---------PWARFCNRFVDTWARDE---------DTVLKHLRASMKKLTRKKGDLPPPAKPEQ 365

  Fly   804 QINQEPSCSASTASSYETVGPGEVHQRPNSDTRSVLSPEYLSADDLQLPDDEDAVRPPPPPAAAA 868
                     .|:||            ||...:|   ..:.|...|.|        .||.|||...
Human   366 ---------GSSAS------------RPVPASR---GGKTLCKGDRQ--------APPGPPARFP 398

  Fly   869 VIITKASVDITNWERSPKAAEGDQMSPLEEQAGESGGAGVNMDALQQPKSACASPASSNGGVYSS 933
            ..|..||        .|:|.......|        ||| |..|..........|||.:.||...|
Human   399 RPIWSAS--------PPRAPRSSTPCP--------GGA-VREDTYPVGTQGVPSPALAQGGPQGS 446

  Fly   934 ELLEQFGLNLHRIEKDV-------------QRCDRNYWYFANENLDKL 968
            ....|:. ::.|:..|:             |.|    |..|....|:|
Human   447 WRFLQWN-SMPRLPTDLDVEGPWFRHYDFRQSC----WVRAISQEDQL 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 14/59 (24%)
TBC1D3ENP_001278395.1 TBC 99..312 CDD:214540 48/252 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..419 24/116 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.