DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32483 and scpl35

DIOPT Version :9

Sequence 1:NP_728540.1 Gene:CG32483 / 318050 FlyBaseID:FBgn0052483 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_196443.1 Gene:scpl35 / 830722 AraportID:AT5G08260 Length:480 Species:Arabidopsis thaliana


Alignment Length:474 Identity:119/474 - (25%)
Similarity:185/474 - (39%) Gaps:92/474 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LAHGKPGYGP--GEQDWGYVDVRPGAH---MFYWLYYTTANVSSYTERPLAIWLQGGPGASSTGY 74
            |..|.||..|  .:...|||::.|...   :|||.:....|.|   .|||.:||.||||.||..|
plant    39 LVTGLPGQPPVNFKHYAGYVNLGPEQKQKALFYWFFEAQQNSS---RRPLVLWLNGGPGCSSIAY 100

  Fly    75 GNFEELGPVDLYGD-----WRSWTWVKDMNVLFIDNPVGSGFSYVDNTAFYTATNKEI-ALDLVE 133
            |..:||||..::.:     :..::|.|:.|:||::.|||.||||.:|:........|: |.|.:.
plant   101 GAAQELGPFLVHDNGGKLTYNHFSWNKEANMLFLEAPVGVGFSYTNNSMDLQKLGDEVTASDSLA 165

  Fly   134 LMKGFYTLHPEFEEVPLHIFCESYGGKMAPEFALELYYAKKRGEVKS---NLTSVALGDPWTSPI 195
            .:..::...|||.....:|..|||.|...|:.| |:.|.:.:...|.   ||....:|:...:..
plant   166 FLINWFMKFPEFRSSEFYISGESYAGHYVPQLA-EVIYDRNKKVTKDSSINLKGFMIGNAVINEA 229

  Fly   196 DSVLAWGPFLREMGIVDHAGYNAI---QEAANFTAQLVEEERWIQATYQWGNTQWEVMKASKGVD 257
            ..:         .|:||:|..:||   :...:.......||.....|.|..|.....|.|...:|
plant   230 TDM---------AGLVDYAWSHAIISDEVHTSIHGSCSFEEDTTNKTEQCYNNFKGFMDAYNDID 285

  Fly   258 FYNVLKETKGGLYQRSKALTSEERLYRTMVKYDIDEDRTKLLEDLM------RGPVAET------ 310
            .|::....     ..|..|:|..|..:.:|     ..|....:||.      ..|..|:      
plant   286 IYSIYTPV-----CLSSLLSSSPRKPKIVV-----SPRLLTFDDLWDKFPAGYDPCTESYAENYF 340

  Fly   311 ------LGIPSNVI-----WGSQSGTTFDIHR-TDFMKPVIHIVNELLEKTPLKVGVFSGGLDLI 363
                  :.:.:||.     :...||.   |.| :|....:|.|:.:|| ...|::.::||..|..
plant   341 NRKDVQVALHANVTNLPYPYSPCSGV---IKRWSDAPSTMIPIIQKLL-TGGLRIWIYSGDTDGR 401

  Fly   364 CATPGTVNWIAKL---------DWSRKDEYLAAPRNGITVDRILEGYQKT-GGNFTMFWINRSGH 418
            .....|...|.|:         .|..|.:              :.|:.:| .|......:..:||
plant   402 VPVTSTRYSIKKMGLKVESPWRSWFHKSQ--------------VAGWVETYAGGLNFVTVRGAGH 452

  Fly   419 MAPADNPAAMSHVLREFTS 437
            ..||..||....:...|.|
plant   453 QVPALAPAQSLTLFSHFIS 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32483NP_728540.1 Peptidase_S10 18..437 CDD:298660 117/469 (25%)
scpl35NP_196443.1 Peptidase_S10 44..471 CDD:278857 116/467 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54069
OrthoDB 1 1.010 - - D625787at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.