DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32483 and SCPL43

DIOPT Version :9

Sequence 1:NP_728540.1 Gene:CG32483 / 318050 FlyBaseID:FBgn0052483 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001323740.1 Gene:SCPL43 / 815721 AraportID:AT2G12480 Length:468 Species:Arabidopsis thaliana


Alignment Length:477 Identity:119/477 - (24%)
Similarity:179/477 - (37%) Gaps:119/477 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GKPGYGPGEQDWGYVDV--RPGAHMFYWLYYTTANVSSYTERPLAIWLQGGPGASSTGYGNFEEL 80
            |:|..| ..|..|||||  ..|..:||  ||..| |.....:||.:||.||||.||.|.|.|.||
plant    37 GQPNVG-FRQFAGYVDVDSENGRSLFY--YYVEA-VKEPDTKPLTLWLNGGPGCSSVGGGAFTEL 97

  Fly    81 GPVDLYGDWR-----SWTWVKDMNVLFIDNPVGSGFSYVDNTAFYTATNKEIALDLVELMKGFYT 140
            ||....||.|     |.:|.|..|:||:::|.|.|:||.:.::.|...:|....|::..:..::.
plant    98 GPFYPTGDGRGLRLNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTGDKSTVNDMLVFLLRWFN 162

  Fly   141 LHPEFEEVPLHIFCESYGGKMAPEFA-LELYYAKKRGEVKSNLTSVALGDP-------WTSPIDS 197
            ..||.:...|.:..|||.|...|:.| :.|.|..:....|.|:..:|:|:|       :.:..:.
plant   163 KFPELKSRDLFLTGESYAGHYIPQLADVILSYNSRSSGFKFNVKGIAIGNPLLKLDRDFAAAYEY 227

  Fly   198 VLAWGPFLREMGI-------------VDHAGYNAIQEAANFT--------------AQLVEEERW 235
            ..:.|....|:.:             :.:|...||.|::..|              ..:|::|..
plant   228 FWSHGMISDEVRLTIMNQCDFANPKNMSNACIYAIVESSVLTEYINSYHILLDVCYPSIVQQELR 292

  Fly   236 IQATYQWGNTQWEVMKASKGVD--------FYNVLKETKGGLYQRSKALTSEERLYRTMVKYDID 292
            ::..         |.|.|..||        ||..|.:.:..|:.....|..|..:....:.|...
plant   293 LKKM---------VTKISMVVDVCITYERSFYFNLPKVQNALHANRTRLPYEWTMCSNRLNYSGI 348

  Fly   293 EDRTKLLEDLMR-----GPVAETLGIPSNVIWGSQSGTTFDIHRTDFMKPVIHIVNELLEKTPLK 352
            :....:|..|.|     .||....|...:|| ..||..|              :|.||.|....|
plant   349 DGYIDMLPSLKRIIQNQTPVWIFSGDQDSVI-PLQSSRT--------------LVRELAEDLNFK 398

  Fly   353 VGVFSGGLDLICATPGTVNWIAKLDWSRKDEYLAAPRNGITVDRILEGYQKTGGNFTMF-WINRS 416
            ..:..|.                  |..|::              :.|:....||...| .:..:
plant   399 TTIPYGA------------------WFHKEQ--------------VGGWVTEYGNLLTFATVRGA 431

  Fly   417 GHMAPADNPAAMSHVLREFTSF 438
            .||.|...|   |..|..|:||
plant   432 AHMVPYAEP---SRALHMFSSF 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32483NP_728540.1 Peptidase_S10 18..437 CDD:298660 117/474 (25%)
SCPL43NP_001323740.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54069
OrthoDB 1 1.010 - - D625787at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.