DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32483 and Y16B4A.2

DIOPT Version :9

Sequence 1:NP_728540.1 Gene:CG32483 / 318050 FlyBaseID:FBgn0052483 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_510452.4 Gene:Y16B4A.2 / 181572 WormBaseID:WBGene00012445 Length:2161 Species:Caenorhabditis elegans


Alignment Length:499 Identity:120/499 - (24%)
Similarity:188/499 - (37%) Gaps:118/499 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GYV--DVRPGAHMFYWLYYTTANVSSYTE---RPLAIWLQGGPGASSTGYGNFEELGPV------ 83
            ||:  |..|..|:|||.      |.|..:   .|:.:||.||||.||.| |.|.||||.      
 Worm  1100 GYLTADETPLNHLFYWF------VESQNDPVNDPVVLWLNGGPGCSSLG-GFFTELGPFHPNDDG 1157

  Fly    84 --DLYGDWRSWTWVKDMNVLFIDNPVGSGFSYVDNTAFY-----TATNKEIALDLVELMKGFY-T 140
              .||.:..||.  |..||:|::.|...||||.::..:|     ||.|...|:      |.|: .
 Worm  1158 GQTLYENVFSWN--KKANVIFLEAPAKVGFSYTEDPNYYWDDDTTAQNNGYAI------KSFFQK 1214

  Fly   141 LHPEFEEVPLHIFCESYGGKMAPEFALELYYAKKRGEVKSNLTSVALGDPWTSPI-----DSVLA 200
            ..|::.:....|..|||||...|...|.|......|.:..|....|:|:...|..     :.||.
 Worm  1215 KFPQYAQNQFFITGESYGGVYCPTLTLNLVQQIDAGILNLNFKGTAVGNGILSEYLQTNSEIVLQ 1279

  Fly   201 WGPFLREMGIVDHAGYNAIQEAANF-TAQLVEEERWIQATYQW---GNTQWEVM----KASKGVD 257
            :|           .|:|.:.:..|. ||..:.....|...||.   |:..::.:    |...|:|
 Worm  1280 YG-----------RGFNGVDDWNNLKTACNLTNSDTIYYDYQGAPEGSACYQAVDDNQKKFYGLD 1333

  Fly   258 F-----YNV-----LKETKG-----GLYQRSKALTSEERLYR-----------TMVKYDIDEDRT 296
            .     ||:     |...||     ...|::|..|..||..|           ..:|:|....:.
 Worm  1334 ERYGDPYNMYQDCYLYNNKGAWQTPSAQQQTKPKTRRERALRAHMNRRKSFASASIKFDNSNSKN 1398

  Fly   297 -----------------KLLEDLMRGPVAETLGIPSNVIW----GSQSGTTFDIHRTDFMKPVIH 340
                             .|:..|.|..|...:......:|    .......|..|..:....:.:
 Worm  1399 WYGSTDPFRGLNCFAGDALVTYLSRDDVQTAIHSRKQPLWVDCADENPANHFRYHTQEKYYDMQN 1463

  Fly   341 IVNELLE-----KTPLKVGVFSGGLDLICATPGTVNWIAKLDWSRKDEYLAAPR------NGITV 394
            .::::::     :..:::..::|.:|.||...|. .|:.:...:|::..:.:||      .|...
 Worm  1464 TISDIMDSKWYTQNSMRLMFYNGDVDTICQFLGD-QWLIEKLVTRRNLTVTSPRQPWYYQQGSQY 1527

  Fly   395 DRILEGYQKT-GGNFTMFWINRSGHMAPADNPAAMSHVLREFTS 437
            ...:.||.|: ..|.....:..|||..|:|.||....:|..|.|
 Worm  1528 VTTIAGYAKSWTQNLVQLTVKGSGHFVPSDRPAQALQMLTNFLS 1571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32483NP_728540.1 Peptidase_S10 18..437 CDD:298660 119/497 (24%)
Y16B4A.2NP_510452.4 Peptidase_S10 38..480 CDD:298660
Peptidase_S10 520..991 CDD:278857
Peptidase_S10 1087..1572 CDD:278857 120/499 (24%)
Peptidase_S10 1610..2061 CDD:278857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.