DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32483 and F22E12.1

DIOPT Version :9

Sequence 1:NP_728540.1 Gene:CG32483 / 318050 FlyBaseID:FBgn0052483 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_505684.2 Gene:F22E12.1 / 179460 WormBaseID:WBGene00009058 Length:763 Species:Caenorhabditis elegans


Alignment Length:99 Identity:23/99 - (23%)
Similarity:31/99 - (31%) Gaps:33/99 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 WLQGGPGASSTGY---------GNFEELGP-VDLYGDWRSWTWVKDMN-------VLFIDNPVGS 109
            |..|..|.|:..|         |.:.|.|| :|      ...|.:.||       :...:||..|
 Worm   116 WWSGCGGNSNIYYSYNHCMLICGEYAEHGPGID------EKYWGRQMNRSMSAESLHVFNNPTES 174

  Fly   110 GFSYVDNTAFYTATNKEIALDLVELMKGFYTLHP 143
            ...|.:..  |...        |.|...:|..||
 Worm   175 FHQYSEEP--YPVQ--------VPLENSYYDSHP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32483NP_728540.1 Peptidase_S10 18..437 CDD:298660 23/99 (23%)
F22E12.1NP_505684.2 KU 25..76 CDD:238057
KU 85..138 CDD:238057 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.