DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32483 and F22E12.1

DIOPT Version :10

Sequence 1:NP_728540.1 Gene:CG32483 / 318050 FlyBaseID:FBgn0052483 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_505684.2 Gene:F22E12.1 / 179460 WormBaseID:WBGene00009058 Length:763 Species:Caenorhabditis elegans


Alignment Length:99 Identity:23/99 - (23%)
Similarity:31/99 - (31%) Gaps:33/99 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 WLQGGPGASSTGY---------GNFEELGP-VDLYGDWRSWTWVKDMN-------VLFIDNPVGS 109
            |..|..|.|:..|         |.:.|.|| :|      ...|.:.||       :...:||..|
 Worm   116 WWSGCGGNSNIYYSYNHCMLICGEYAEHGPGID------EKYWGRQMNRSMSAESLHVFNNPTES 174

  Fly   110 GFSYVDNTAFYTATNKEIALDLVELMKGFYTLHP 143
            ...|.:..  |...        |.|...:|..||
 Worm   175 FHQYSEEP--YPVQ--------VPLENSYYDSHP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32483NP_728540.1 Peptidase_S10 18..437 CDD:459815 23/99 (23%)
F22E12.1NP_505684.2 Kunitz-type 25..76 CDD:438633
KU 85..137 CDD:197529 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.