DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppt1 and AT5G47340

DIOPT Version :9

Sequence 1:NP_001285024.1 Gene:Ppt1 / 31805 FlyBaseID:FBgn0030057 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_199545.2 Gene:AT5G47340 / 834781 AraportID:AT5G47340 Length:317 Species:Arabidopsis thaliana


Alignment Length:309 Identity:77/309 - (24%)
Similarity:147/309 - (47%) Gaps:26/309 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SCILFLLFLIFSLVLSYIWWSPTKGGTNPEVLPVVLWHGMGDTCCVPFSLGAIMNLIVEQTKGGY 74
            ||::.::..:..:.:|.             .:|.::.||:...|  .....|....::....|..
plant     8 SCVMVVVAFLAKVDISV-------------SVPFIMLHGIASQC--SDDTNANFTQLLTNLSGSP 57

  Fly    75 VRSLQIGGNVLIDWQSGFFIHPNEQVDYVCKQLLQDEHLAKGYHAIGFSQGGQFLRAVAERCP-N 138
            ...|:||..|:    :..|:...:|.:..|:.:.:.:.|::||:.:|.|||....|.:.|.|. .
plant    58 GFCLEIGNGVI----NSMFLPLTQQAEIACENVKEMKELSQGYNIVGRSQGNLVARGLIEFCDGG 118

  Fly   139 PPMRNLITLGGQHQGIFGLP--MCPTLTEKPCDYITRLLDNAAYAPEVQKALVQATYWHDPIMEN 201
            ||:.|.|:|.|.|.||..||  :|...::..|.....|:..|.|:..:|..|..:.|:..|....
plant   119 PPVFNYISLAGPHAGISSLPRGLCGLTSDPACKKFNELIKGALYSETIQDHLAPSGYYKIPNDMK 183

  Fly   202 KYRLGSTFLADINNEL--FINKFYIENLQKLKKFVMVQFLNDTIVQPKESQWFQYYTTGQNKVIQ 264
            :|...|.:|..:|||:  ..|:.|.:....|...|:|:|.:|.::.|.:|.||.:|..|:.:.:.
plant   184 QYLERSKYLPKLNNEIPNQRNQTYKDRFTSLHNLVLVKFQDDEVITPNDSTWFGFYPDGEFETLL 248

  Fly   265 PFTESKVYQD--LGLDKMHRQGQLVFLGVEGDHLAISKAWFIQNIVPLL 311
            ...::|:|.:  :||..:...|::.|:.|.|.|:.:::...::.:||.|
plant   249 SANQTKLYTEDWIGLKTLDDAGKVKFVSVPGGHVRMAEEDVVKYVVPYL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppt1NP_001285024.1 Abhydrolase 38..311 CDD:304388 73/279 (26%)
AT5G47340NP_199545.2 PLN02633 1..317 CDD:178240 77/309 (25%)
Abhydrolase 1..306 CDD:304388 77/309 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1924
eggNOG 1 0.900 - - E1_COG1075
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I1880
OMA 1 1.010 - - QHG54894
OrthoDB 1 1.010 - - D904122at2759
OrthoFinder 1 1.000 - - FOG0002319
OrthoInspector 1 1.000 - - otm2624
orthoMCL 1 0.900 - - OOG6_102448
Panther 1 1.100 - - O PTHR11247
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X458
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.