DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppt1 and AT5G47330

DIOPT Version :9

Sequence 1:NP_001285024.1 Gene:Ppt1 / 31805 FlyBaseID:FBgn0030057 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_199544.1 Gene:AT5G47330 / 834780 AraportID:AT5G47330 Length:314 Species:Arabidopsis thaliana


Alignment Length:280 Identity:76/280 - (27%)
Similarity:136/280 - (48%) Gaps:15/280 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LPVVLWHGMGDTCCVPFSLGAIMNLIVEQTKGGYVRSLQIGGNVLIDWQSGFFIHP-NEQVDYVC 104
            :|.::.||:...|  ..:..|....::....|.....|:||..|...|     :.| ..|.:..|
plant    27 VPFIMLHGISAQC--SNARDANFTQLLTNLSGSPGFCLEIGNGVADSW-----LMPLTRQAEIAC 84

  Fly   105 KQLLQDEHLAKGYHAIGFSQGGQFLRAVAERCP-NPPMRNLITLGGQHQGIFGLPMCPTLTEKPC 168
            :::.|.:.|::||:.:|.|||....|.:.|.|. .||:.|.|:|.|.|.||..:|||.  :...|
plant    85 EKVKQMKELSQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYISLAGPHAGISSVPMCG--SGLFC 147

  Fly   169 DYITRLLDNAAYAPEVQKALVQATYWHDPIMENKYRLGSTFLADINNEL--FINKFYIENLQKLK 231
            .....|:....|:..:|..|..:.|...|....||...|.:|..:|||:  ..|:.|.:....|.
plant   148 KLADELIKGDIYSDFIQDHLAPSGYLKIPTDMTKYLGSSKYLPKLNNEIPDQRNQTYKDRFTSLH 212

  Fly   232 KFVMVQFLNDTIVQPKESQWFQYYTTGQNKVIQPFTESKVYQD--LGLDKMHRQGQLVFLGVEGD 294
            ..|:::|..|.::.||:|.||.:|..|:.:.:....::|:|.:  :||..:...|::.|:.|.|:
plant   213 NLVLIKFQGDKVIVPKDSSWFGFYPDGEFEPLLSAQQTKLYTEDWIGLKTLDDAGKVKFVSVAGE 277

  Fly   295 HLAISKAWFIQNIVPLLLEK 314
            |:.:.....::::||.|.::
plant   278 HIRMVDEDVVKHVVPYLQDQ 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppt1NP_001285024.1 Abhydrolase 38..311 CDD:304388 75/275 (27%)
AT5G47330NP_199544.1 PLN02633 2..314 CDD:178240 76/280 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1924
eggNOG 1 0.900 - - E1_COG1075
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I1880
OMA 1 1.010 - - QHG54894
OrthoDB 1 1.010 - - D904122at2759
OrthoFinder 1 1.000 - - FOG0002319
OrthoInspector 1 1.000 - - otm2624
orthoMCL 1 0.900 - - OOG6_102448
Panther 1 1.100 - - O PTHR11247
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X458
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.