DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppt1 and DOLPP1

DIOPT Version :9

Sequence 1:NP_001285024.1 Gene:Ppt1 / 31805 FlyBaseID:FBgn0030057 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_065171.2 Gene:DOLPP1 / 57171 HGNCID:29565 Length:238 Species:Homo sapiens


Alignment Length:63 Identity:18/63 - (28%)
Similarity:28/63 - (44%) Gaps:10/63 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 WFQYYTTGQNKVIQPFTESKVYQDLGLDKMHRQGQLVFLGVEGDHLAISKAWFI---QNIVPL 310
            |....:.|...|....:.|:||.     ..|...|:::.|:.|..:||  ||||   :.:.||
Human   135 WRHVLSLGLLAVAFLVSYSRVYL-----LYHTWSQVLYGGIAGGLMAI--AWFIFTQEVLTPL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppt1NP_001285024.1 Abhydrolase 38..311 CDD:304388 18/63 (29%)
DOLPP1NP_065171.2 PAP2_dolichyldiphosphatase 16..180 CDD:239477 13/51 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8690
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.