powered by:
Protein Alignment Ppt1 and DOLPP1
DIOPT Version :9
Sequence 1: | NP_001285024.1 |
Gene: | Ppt1 / 31805 |
FlyBaseID: | FBgn0030057 |
Length: | 314 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_065171.2 |
Gene: | DOLPP1 / 57171 |
HGNCID: | 29565 |
Length: | 238 |
Species: | Homo sapiens |
Alignment Length: | 63 |
Identity: | 18/63 - (28%) |
Similarity: | 28/63 - (44%) |
Gaps: | 10/63 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 251 WFQYYTTGQNKVIQPFTESKVYQDLGLDKMHRQGQLVFLGVEGDHLAISKAWFI---QNIVPL 310
|....:.|...|....:.|:||. ..|...|:::.|:.|..:|| |||| :.:.||
Human 135 WRHVLSLGLLAVAFLVSYSRVYL-----LYHTWSQVLYGGIAGGLMAI--AWFIFTQEVLTPL 190
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R8690 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.