DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppt1 and Ppt2

DIOPT Version :9

Sequence 1:NP_001285024.1 Gene:Ppt1 / 31805 FlyBaseID:FBgn0030057 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_062240.1 Gene:Ppt2 / 54398 RGDID:620375 Length:302 Species:Rattus norvegicus


Alignment Length:295 Identity:74/295 - (25%)
Similarity:119/295 - (40%) Gaps:57/295 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLFLIFSLVLSYIWWSPTKGGTNPEVLPVVLWHGMGDTCCVPFSLGAIMNLIVEQTKGGYVRSLQ 79
            ||.|.|..:|.....:|.:|...    ||::.||:.|:   .:|...:::.|.|...|..|..|.
  Rat    15 LLLLPFLPLLLPAAPAPHRGSYK----PVIVVHGLFDS---SYSFRHLLDYINETHPGTVVTVLD 72

  Fly    80 IGGNVLID--------WQ--SGFFIHPNEQVDYVCKQLLQDEHLAKGYHAIGFSQGGQFLRAVAE 134
                 |.|        |:  .||    .|.|..:.      |...:|.|.|.:||||...||:..
  Rat    73 -----LFDGRESLRPLWEQVQGF----REAVVPIM------EKAPEGVHLICYSQGGLVCRALLS 122

  Fly   135 RCPNPPMRNLITLGGQHQGIFGLPMCPTLTEKPCDYITRL--------LDNAAYAPEVQKALVQA 191
            ......:.:.|:|.....|.:|          ..||:..|        |....|:|..|:..: .
  Rat   123 VMDEHNVDSFISLSSPQMGQYG----------DTDYLKWLFPTSMRSNLYRICYSPWGQEFSI-C 176

  Fly   192 TYWHDPIMENKYRLGSTFLADINNELFINK--FYIENLQKLKKFVMVQFLNDTIVQPKESQWFQY 254
            .|||||..::.|...|:|||.||.|.....  .:.:|..::.:.|::...:|.::.|.:|.:|.:
  Rat   177 NYWHDPHHDDLYLNASSFLALINGERDHPNATAWRKNFLRVGRLVLIGGPDDGVITPWQSSFFGF 241

  Fly   255 YTTGQNKVIQPFTESKVY--QDLGLDKMHRQGQLV 287
            |..  |:.:....|..||  ...||..:..:|.:|
  Rat   242 YDA--NETVLEMEEQPVYLRDSFGLKTLLARGAIV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppt1NP_001285024.1 Abhydrolase 38..311 CDD:304388 67/272 (25%)
Ppt2NP_062240.1 Palm_thioest 38..283 CDD:396594 67/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54894
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X458
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.