DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppt1 and ppt2a.3

DIOPT Version :9

Sequence 1:NP_001285024.1 Gene:Ppt1 / 31805 FlyBaseID:FBgn0030057 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001296460.1 Gene:ppt2a.3 / 406830 ZFINID:ZDB-GENE-040426-2909 Length:291 Species:Danio rerio


Alignment Length:292 Identity:77/292 - (26%)
Similarity:115/292 - (39%) Gaps:57/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILFLLFLIFSLVLSYIWWSPTKGGTNPEVLPVVLWHGM--GDTCCVPFSLGAIMNLIVEQTKGGY 74
            ||.:|.|:.|.:::|              .||::.||:  |.....||     :|.|.|...|..
Zfish    11 ILVVLLLLPSAIMAY--------------RPVIIIHGLFGGPKELTPF-----VNFIKESHPGTS 56

  Fly    75 VRS---LQIGGNVLIDW--QSGFFIHPNEQVDYVCKQLLQD--EHLAKGYHAIGFSQGGQFLRAV 132
            |.:   .:...:|...|  ..||            |:::|.  |....|.|.|.:||||...|.|
Zfish    57 VTAPSLYEYAASVKPMWVQVEGF------------KKVIQPIMESAEDGVHLICYSQGGLICRGV 109

  Fly   133 AERCPNPPMRNLITLGGQHQGIFGLP-----MCPTLTEKPCDYITRLLDNAAYAPEVQKALVQAT 192
            ....|.....::|.|.....|.:|:.     :.|.|.:..       |.|..|....||... .:
Zfish   110 LATLPQHNAHSVIFLSSPLAGQYGVTRAISGVFPKLPKSS-------LHNVCYTELGQKTSF-CS 166

  Fly   193 YWHDPIMENKYRLGSTFLADINNEL-FINKF-YIENLQKLKKFVMVQFLNDTIVQPKESQWFQYY 255
            ||:||....||...|.|||.:|.|: .:|.. :..|..::|..|::...||.::.|.:|..|..|
Zfish   167 YWNDPHHREKYLNSSVFLAPLNGEVEHVNSTEWRNNFLRIKTMVLIGGPNDGVILPWQSSMFGSY 231

  Fly   256 TTGQNKVIQPFTESKVYQD-LGLDKMHRQGQL 286
            .. ..|||....:....:| .||..:..||.|
Zfish   232 DR-NGKVIDMENQDFYVRDTFGLKTLKSQGVL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppt1NP_001285024.1 Abhydrolase 38..311 CDD:304388 71/266 (27%)
ppt2a.3NP_001296460.1 Abhydrolase 27..260 CDD:304388 68/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54894
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X458
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.