DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppt1 and ppt2a.4

DIOPT Version :9

Sequence 1:NP_001285024.1 Gene:Ppt1 / 31805 FlyBaseID:FBgn0030057 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_998074.1 Gene:ppt2a.4 / 405845 ZFINID:ZDB-GENE-040426-2211 Length:291 Species:Danio rerio


Alignment Length:284 Identity:76/284 - (26%)
Similarity:120/284 - (42%) Gaps:47/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILFLLFLIFSLVLSYIWWSPTKGGTNPEVLPVVLWHGM-GDTCCVPFSLGAIMNLIVEQTKGGYV 75
            ||.:|.|:.|.:::|              .||::.||: |.    |..:..::|||.|...|..|
Zfish    11 ILVVLLLLPSAIMAY--------------RPVIIIHGLFGG----PVQMTPLVNLIKESHPGTSV 57

  Fly    76 RSLQIGGNVLIDWQSGFFIHPN-EQVDYVCKQLLQD--EHLAKGYHAIGFSQGGQFLRAVAERCP 137
            .::.     |.|:...  :.|. :||:.. |::||.  |....|.|.|.:||||...|.|....|
Zfish    58 TAVS-----LYDYTDS--VKPMWDQVEGF-KKVLQPIIESTGDGVHLICYSQGGLICRGVLATLP 114

  Fly   138 NPPMRNLITLGGQHQGIFGLP-----MCPTLTEKPCDYITRLLDNAAYAPEVQKALVQATYWHDP 197
            .....::|.|.....|.:|:.     :.|.|.:..       |.|..|....||... .:||:||
Zfish   115 QHNAHSVIFLSSPLAGQYGVTRAISGVFPKLPKSS-------LHNVCYTELGQKTSF-CSYWNDP 171

  Fly   198 IMENKYRLGSTFLADINNEL-FINKF-YIENLQKLKKFVMVQFLNDTIVQPKESQWFQYYTTGQN 260
            ....||...|.|||.:|.|: .:|.. :..|..::|..|::...||.::.|.:|..|..:.: ..
Zfish   172 HHREKYLNSSVFLAPLNGEVEHVNSTEWRNNFLRIKTMVLIGGPNDGVILPWQSSMFGSFDS-DG 235

  Fly   261 KVIQPFTESKVYQD-LGLDKMHRQ 283
            |||....:....:| .||..:..|
Zfish   236 KVIDMENQDFYVRDTFGLKTLKSQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppt1NP_001285024.1 Abhydrolase 38..311 CDD:304388 70/258 (27%)
ppt2a.4NP_998074.1 MhpC 26..291 CDD:223669 70/255 (27%)
Abhydrolase 27..269 CDD:304388 70/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54894
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X458
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.