DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl14 and EVA1C

DIOPT Version :9

Sequence 1:NP_728509.1 Gene:mthl14 / 318046 FlyBaseID:FBgn0052476 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_478067.2 Gene:EVA1C / 59271 HGNCID:13239 Length:441 Species:Homo sapiens


Alignment Length:233 Identity:47/233 - (20%)
Similarity:73/233 - (31%) Gaps:74/233 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PADCSQREKY-----------RKQPVATPSSRLRKCCPHGENLNIY-----RENQSDSMCDN--- 141
            |..|....||           .|.........|:..|...:.||||     |..|...:|.:   
Human   142 PDLCPGSSKYLLVSFKCQPNELKNKTVCEDQELKLHCHESKFLNIYSATYGRRTQERDICSSKAE 206

  Fly   142 GLLSFEPTIISA--VLFDNCIEDLEVETTL-DYDIGNPC----NSSLLYDDKDDVFFVLQDGSLL 199
            .|..|:....||  ||...|......:..: ::..|:||    ...|..     .:..:....|.
Human   207 RLPPFDCLSYSALQVLSRRCYGKQRCKIIVNNHHFGSPCLPGVKKYLTV-----TYACVPKNILT 266

  Fly   200 IID-KFGNESYTVKE---HYCLDIDKSG-------------HLFAFTCVTQVEEQIAFAKVVFVA 247
            .|| ...|...::|:   .|.::.|.||             .|.||..:....|:         |
Human   267 AIDPAIANLKPSLKQKDGEYGINFDPSGSKVLRKDGILVSNSLAAFAYIRAHPER---------A 322

  Fly   248 VLMLISMPCLLLVSYLHMTLRLLRNLHGLSLSLMSLCL 285
            .|:.:|..|:                 ||:|:|.:|.:
Human   323 ALLFVSSVCI-----------------GLALTLCALVI 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl14NP_728509.1 7tmB3_Methuselah-like 239..512 CDD:320167 9/47 (19%)
TM helix 1 241..266 CDD:320167 4/24 (17%)
TM helix 2 275..297 CDD:320167 5/11 (45%)
TM helix 3 306..331 CDD:320167
TM helix 4 349..369 CDD:320167
TM helix 5 389..418 CDD:320167
TM helix 6 445..472 CDD:320167
TM helix 7 477..502 CDD:320167
EVA1CNP_478067.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Gal_Lectin 75..158 CDD:280328 4/15 (27%)
Gal_Lectin 176..259 CDD:280328 19/87 (22%)
FAM176 301..441 CDD:291517 13/69 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..390
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159005
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.