DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl14 and eva1c

DIOPT Version :9

Sequence 1:NP_728509.1 Gene:mthl14 / 318046 FlyBaseID:FBgn0052476 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_009303778.2 Gene:eva1c / 564385 ZFINID:ZDB-GENE-091204-329 Length:439 Species:Danio rerio


Alignment Length:292 Identity:48/292 - (16%)
Similarity:92/292 - (31%) Gaps:88/292 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VLDASIHSTLVVPQTYSTEAATISGAR-----------FATSVPVQSPVDNPLDPADCS---QRE 103
            :|....|||:.:...:..::.|:.|..           .:.|..:|..:.......||.   ..:
Zfish    59 ILKCPRHSTITIQSAFYGQSETLVGLEPRMRCQWHNHSCSASTTLQKVLSECQGHRDCQFLVNHQ 123

  Fly   104 KYRKQP----------------------VATPSSRLRKCCPHGENLNIY-----RENQSDSMCD- 140
            .:.|.|                      |.....||...|.:.:.||||     |..:.:.:|. 
Zfish   124 VFGKDPCPGIPKYINVSYRCKPTEHKRKVTCEGDRLLLHCKYPKVLNIYSAVYGRLLEEEDLCSS 188

  Fly   141 -----------NGLLSFEPTIISAVLF--DNCIEDLEVETTLDYDIGNPCNS------SLLYDDK 186
                       :|.:.    ::|.:.:  ..|:..::.:...|     ||..      ::||...
Zfish   189 EEQKPPYECLHHGAVD----VVSNICYGKQRCLFTVDQKHFKD-----PCPPGTKKYITILYACV 244

  Fly   187 DDVFFVLQDGSLLIIDKFGNESYTVKEHYCLDIDK--------SGHLFAFTCVTQVEEQIAFAKV 243
            ........|.|..:.....::|....|...:...|        |..|..|..:|:..|       
Zfish   245 PQSLLKEADPSSFLTTSMPSQSTKEAERPVIRSSKFPEGGIILSNALMGFGYITEHPE------- 302

  Fly   244 VFVAVLMLISMPCL-LLVSYLHMTLRLLRNLH 274
              :|.|:..|..|: ||:..:.::.:|..:.|
Zfish   303 --MAGLLFTSSVCVGLLIVLIAVSTQLTCSRH 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl14NP_728509.1 7tmB3_Methuselah-like 239..512 CDD:320167 8/37 (22%)
TM helix 1 241..266 CDD:320167 6/25 (24%)
TM helix 2 275..297 CDD:320167 48/292 (16%)
TM helix 3 306..331 CDD:320167
TM helix 4 349..369 CDD:320167
TM helix 5 389..418 CDD:320167
TM helix 6 445..472 CDD:320167
TM helix 7 477..502 CDD:320167
eva1cXP_009303778.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594990
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.