DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl14 and CG15556

DIOPT Version :9

Sequence 1:NP_728509.1 Gene:mthl14 / 318046 FlyBaseID:FBgn0052476 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001247379.1 Gene:CG15556 / 43681 FlyBaseID:FBgn0039821 Length:755 Species:Drosophila melanogaster


Alignment Length:402 Identity:77/402 - (19%)
Similarity:129/402 - (32%) Gaps:121/402 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 LQDGSLLIIDKFGNESYTVKEHYCLDIDKSGHLFAFTCVTQVEEQIA--------FAKVVFVAVL 249
            |.||    |...|..|.....|..: :..:.||..||.:..|.:..|        .:..|...|.
  Fly   409 LSDG----ISTSGGGSLEASSHPVI-LCHADHLTQFTFLLGVSKMQAGLDTNEDDHSLDVITNVG 468

  Fly   250 MLISMPCLLLVSYLHMTLRLLRNLHGLSLSLMSLCLASG-----YFVHSVVHIYGIPNQG----- 304
            :.:|:..||::.......:..|.|....: |::||.|.|     :.:.|..|:.....|.     
  Fly   469 LTLSLLGLLMIFITAAVFKSFRTLASTKI-LLNLCAALGLQLLFFLILSQSHLLEQLEQSESERC 532

  Fly   305 -FIGYVIQFCILSYFFWYLCICF-----------------NVLLN---VW-----------YKLP 337
             .:|.|:|:.:|..|.|...|.|                 .:|::   .|           :..|
  Fly   533 TLVGAVMQYLLLVVFSWMFIIGFLQYQRYVRVIGVNHPRHYILMSAVAAWTLPLIPTLLVVFLEP 597

  Fly   338 CCIQCSKSWATFNFACYAVFAFSGPATIVALTVQKGLPGMPSYFLQGLTESIRDSQRYFIPPVST 402
            ...:.:.|...:...||.    ||....:.:.:..||..:.:..|.|          |....|.|
  Fly   598 GSYRPNNSSMDYPILCYP----SGYGLSLGVILPIGLITVANAILVG----------YISWSVYT 648

  Fly   403 ILFLSFLLNIISFFGFQRISGYAKAEKNIQERKCLFDQQKYEDVKKDAKCVSLLGIIMVVSWLLE 467
            .||                           :|..:|         |......||..::.::|:..
  Fly   649 ALF---------------------------KRDLIF---------KQLGLFVLLFFLLGITWIFG 677

  Fly   468 IITFYSGSNSNYLILCDMVNGLQGVWVLLIFLVVRRRRTIILRWWY--------DRGSHEIE--- 521
            :.|::........:.| :...|||..:.|.|:|..:...   |.|.        .|....|:   
  Fly   678 LCTYFDFGRIFAYLFC-LTATLQGFVLFLYFIVFNKENQ---RAWLGLCCNSSKKRNQQTIQMPT 738

  Fly   522 GTELQALSNSPT 533
            .:.||.||:|.|
  Fly   739 DSILQGLSHSST 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl14NP_728509.1 7tmB3_Methuselah-like 239..512 CDD:320167 56/322 (17%)
TM helix 1 241..266 CDD:320167 5/24 (21%)
TM helix 2 275..297 CDD:320167 6/26 (23%)
TM helix 3 306..331 CDD:320167 9/41 (22%)
TM helix 4 349..369 CDD:320167 4/19 (21%)
TM helix 5 389..418 CDD:320167 5/28 (18%)
TM helix 6 445..472 CDD:320167 5/26 (19%)
TM helix 7 477..502 CDD:320167 7/24 (29%)
CG15556NP_001247379.1 7tm_4 481..703 CDD:304433 46/273 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.