Sequence 1: | NP_728509.1 | Gene: | mthl14 / 318046 | FlyBaseID: | FBgn0052476 | Length: | 533 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_610960.1 | Gene: | Dh44-R1 / 36601 | FlyBaseID: | FBgn0033932 | Length: | 504 | Species: | Drosophila melanogaster |
Alignment Length: | 295 | Identity: | 65/295 - (22%) |
---|---|---|---|
Similarity: | 102/295 - (34%) | Gaps: | 95/295 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 153 AVLFDNCIEDLEVETTLDYDIGNPCNSSLLYDDKDDVFFVLQDGSLLIIDKFGNESYTVKEHYCL 217
Fly 218 DIDKSGHLFAFTCVTQVEEQIAFAKVVFVA--VLMLISMPCLLLVSYLHMTLRLLRN-------- 272
Fly 273 ------LHGLSLSLMSLCLASGYFVHSVVHIYGIPNQGFIGYVIQFCILSYFFWYLCICFNVLLN 331
Fly 332 VWYKLPCCIQCSKSWATFNFACYAVFAFSGPAT-IVALTVQKGLPGMPSYFLQGLTESIRDSQRY 395
Fly 396 FI---------------PPVSTILF--LSFLLNII 413 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mthl14 | NP_728509.1 | 7tmB3_Methuselah-like | 239..512 | CDD:320167 | 46/209 (22%) |
TM helix 1 | 241..266 | CDD:320167 | 5/26 (19%) | ||
TM helix 2 | 275..297 | CDD:320167 | 5/21 (24%) | ||
TM helix 3 | 306..331 | CDD:320167 | 6/24 (25%) | ||
TM helix 4 | 349..369 | CDD:320167 | 7/20 (35%) | ||
TM helix 5 | 389..418 | CDD:320167 | 10/42 (24%) | ||
TM helix 6 | 445..472 | CDD:320167 | |||
TM helix 7 | 477..502 | CDD:320167 | |||
Dh44-R1 | NP_610960.1 | HRM | 52..112 | CDD:397086 | 14/70 (20%) |
7tmB1_DH_R | 126..394 | CDD:320391 | 46/210 (22%) | ||
TM helix 1 | 129..153 | CDD:320391 | 5/23 (22%) | ||
TM helix 2 | 162..183 | CDD:320391 | 2/20 (10%) | ||
TM helix 3 | 197..219 | CDD:320391 | 6/37 (16%) | ||
TM helix 4 | 238..254 | CDD:320391 | 6/15 (40%) | ||
TM helix 5 | 279..302 | CDD:320391 | 5/22 (23%) | ||
TM helix 6 | 327..349 | CDD:320391 | |||
TM helix 7 | 356..381 | CDD:320391 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45462168 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |