DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl14 and CG15744

DIOPT Version :9

Sequence 1:NP_728509.1 Gene:mthl14 / 318046 FlyBaseID:FBgn0052476 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_572870.2 Gene:CG15744 / 2768909 FlyBaseID:FBgn0030466 Length:1797 Species:Drosophila melanogaster


Alignment Length:179 Identity:37/179 - (20%)
Similarity:70/179 - (39%) Gaps:31/179 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FNASAQISTVNNSSK-----GSNNSNIFHEDTF----NSTSIDVLDASIHSTLVVPQTYSTEAAT 74
            |:...|..::||.|:     |....|....|:.    .|:.:.|.:.|......:.|.||..::.
  Fly  1540 FSQQQQSKSLNNISEMLAGGGGGGGNAPGLDSLGDQQESSQLSVNEGSTLEEQQLRQIYSCSSSN 1604

  Fly    75 IS---GARFATSVPVQSP----VDNPLDPADCSQREKYRKQPVATPSSRLRKCCPHGEN-LNI-- 129
            :|   |.....:|..:..    ..:|.:.:|.:    |:...::..|..|  ..|..:| ||:  
  Fly  1605 LSQLKGHHPTATVDTEDDGRLLSGSPTNESDLN----YQNSEISIRSHGL--YAPQADNDLNLTL 1663

  Fly   130 ---YRENQSDSMCD---NGLLSFEPTIISAVLFDNCIEDLEVETTLDYD 172
               :|..||.:..|   :.|..|:...::|...:..:.|.|.:...|:|
  Fly  1664 TDDFRCYQSSNASDADVDVLNEFDDEFVAATGGERVVGDAEQDPHHDHD 1712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl14NP_728509.1 7tmB3_Methuselah-like 239..512 CDD:320167
TM helix 1 241..266 CDD:320167
TM helix 2 275..297 CDD:320167
TM helix 3 306..331 CDD:320167
TM helix 4 349..369 CDD:320167
TM helix 5 389..418 CDD:320167
TM helix 6 445..472 CDD:320167
TM helix 7 477..502 CDD:320167
CG15744NP_572870.2 LRR_8 107..168 CDD:290566
LRR_4 107..147 CDD:289563
leucine-rich repeat 109..133 CDD:275378
leucine-rich repeat 134..157 CDD:275378
LRRCT 166..216 CDD:214507
IG_like 229..344 CDD:214653
HRM <366..412 CDD:295297
7tm_4 768..>975 CDD:304433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.