DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and EXOG

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_005098.2 Gene:EXOG / 9941 HGNCID:3347 Length:368 Species:Homo sapiens


Alignment Length:228 Identity:86/228 - (37%)
Similarity:124/228 - (54%) Gaps:6/228 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KFGFP--GLDDLRLYSDFVLSYDRRNRVAHWVCEHLQADSIHPNRGRRGRNPYQPDLSVPSNFRS 139
            :||||  | .:.|.|::..||||:..||..||.||:....|..:..|: ...::||.::|..|.:
Human    64 QFGFPLTG-TEARCYTNHALSYDQAKRVPRWVLEHISKSKIMGDADRK-HCKFKPDPNIPPTFSA 126

  Fly   140 ELSDYRRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQYVRNLVHRFG 204
            ...||..||:.|||:|.|||:........:||:|:||.||.... |...||.:|.|.|.|..||.
Human   127 FNEDYVGSGWSRGHMAPAGNNKFSSKAMAETFYLSNIVPQDFDN-NSGYWNRIEMYCRELTERFE 190

  Fly   205 SVFVCTGPLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFFKVIMVESKLHLGKPYMEG-YVLPNAP 268
            .|:|.:|||..|..|..||..|.|::||.:.||||:|.:|||:........:|...| :|:||..
Human   191 DVWVVSGPLTLPQTRGDGKKIVSYQVIGEDNVAVPSHLYKVILARRSSVSTEPLALGAFVVPNEA 255

  Fly   269 IPDGLPLRSFLCDIREIEHYAGLKFFDGLRRSA 301
            |.....|..|...::::|..:||.||..|.|::
Human   256 IGFQPQLTEFQVSLQDLEKLSGLVFFPHLDRTS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 85/225 (38%)
EXOGNP_005098.2 NUC 77..286 CDD:214683 79/210 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.