DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and XB5812267

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001072816.1 Gene:XB5812267 / 780277 XenbaseID:XB-GENE-5812268 Length:297 Species:Xenopus tropicalis


Alignment Length:265 Identity:63/265 - (23%)
Similarity:90/265 - (33%) Gaps:78/265 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AYYLSPKIYEVFT----FF-------------ESNNEDD-----HRMRQIMKFGFPGLDD----L 86
            |:...|.|.|.|:    ||             :.|.||.     .|.:.|..|.  .|.|    :
 Frog    15 AHKAEPLISENFSECREFFYRRQIPQGFEGIAQKNVEDSPAYICQRYKNIDYFA--SLYDRGRHV 77

  Fly    87 RLYSDFVL-----SYDRRNRVAHWVCEHLQADSIHPNRGRRGRNPYQ----------PDLSVPSN 136
            .|||.::|     |..|||..           .:.|.....|.:|..          .|..:|.|
 Frog    78 PLYSAYILNRKHESLHRRNTF-----------DVEPQLINIGLSPSMQSESTTETAITDKKIPGN 131

  Fly   137 FRSEL-------SDYRRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQ 194
            .::.:       :||....:.||||... .||..:...:.||.|||..|.| .|||:..|...|:
 Frog   132 PKTLIAFSQAVNADYGNRSYHRGHLNPV-CHHETKAAQDATFTLTNAVPMV-SGFNQGKWRVHEK 194

  Fly   195 YVRNLVHRFGSVFVCTGPLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFFKVIMVESKLHLGKPYM 259
            .:..........:|.|| :...|.|..            |.|.:|:..:......:  :.|||..
 Frog   195 RMIEETKDCNITYVVTG-IIPGNNRLN------------NRVNIPSRVWSAYCCVN--NNGKPVK 244

  Fly   260 EGYVL 264
            .|.||
 Frog   245 SGAVL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 52/217 (24%)
XB5812267NP_001072816.1 Endonuclease_NS 65..271 CDD:214889 51/215 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.