DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and CG14062

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster


Alignment Length:173 Identity:42/173 - (24%)
Similarity:63/173 - (36%) Gaps:44/173 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 VPSNFRSELSDYRRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQYVR 197
            :|:|        |....:||||||:.:.......|. ||...|..||. :..|...|..:|::||
  Fly   188 IPNN--------RDVIINRGHLAASADFFFGDQLCA-TFKYVNAVPQF-KSINDGNWETIERFVR 242

  Fly   198 NLVHRFGSVFVCTGPLYKPNQRPGGKWAVEYE--------MIGLNMVAVPTHFFKVIM------V 248
            |.|  .|:.||        |.|.|.:..:...        .:..|...||...:|::.      :
  Fly   243 NSV--TGNNFV--------NVRTGARGVLSLPSGNRPKNVFLSGNRNPVPQWMYKIVRNANNQPI 297

  Fly   249 ESKLHLGKPY-MEGYVLPNAPIPDGLPLR---------SFLCD 281
            .:.|.|...| .:....||...|...|:.         ||.|:
  Fly   298 VAFLTLNNIYARQRPAAPNFCQPVNCPVALVNTAQAGFSFCCN 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 42/173 (24%)
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 42/173 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.