DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and CG3819

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001262027.1 Gene:CG3819 / 40069 FlyBaseID:FBgn0036833 Length:423 Species:Drosophila melanogaster


Alignment Length:348 Identity:80/348 - (22%)
Similarity:121/348 - (34%) Gaps:81/348 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VTALCASFVGGMYFQHTDARKRLRELIQTDPYAYYLSPKIYEVFTFFESNNEDDHRMRQIMKFGF 80
            |||.|   |||..|:..|....|..:..|.          :.||...:|.:..:.. ..::|.||
  Fly   106 VTAKC---VGGTTFKIDDKEHDLSAIKCTS----------WPVFVGKKSGSSCNGG-TTLIKVGF 156

  Fly    81 PGLDDLRLYSDFVLSYDRRNRVAHWVCEHLQ---------ADSIHPNRGR--RGRN--------- 125
            . |...|..:.:.:.::....|..:|...|:         .|.|....|.  .|:|         
  Fly   157 E-LSGSRFATQYEVCFNEDEEVTRYVYHRLEPGNNYYATGVDRITFGAGGYFAGKNVDKLYTQAV 220

  Fly   126 ---PYQPDLSVPSNFRSELSDYRRSGF-DRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNR 186
               ....:|.:.|   |...|..::.| .|||:.|..:....... ..||...|.||| .|.||.
  Fly   221 QKETIDKELDMDS---SRFFDSAKNIFLARGHMGAKADFVFAPEQ-RATFLFINAAPQ-WQTFNA 280

  Fly   187 SAWNNLEQYVRNLVHRFGSVFVC-TG-------PLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFF 243
            ..|..:|..||..|.:......| ||       |.....||   :..:.::..|..::.||..:|
  Fly   281 GNWARVEDGVRAWVAKENKHVECWTGVWGVTTLPNKNGEQR---QLYLSHDNNGNGLIPVPKLYF 342

  Fly   244 KVIMVESKLHLGKPYMEGYVLPNAPIPDGLPLRS-----FLC-DIREIEHYAGLKFFDGLRRSAL 302
            :|::..|.       .:|.||.....|. |.|..     .|| |:.:..::...|     :....
  Fly   343 RVVIEPST-------KKGIVLIGVNNPH-LSLEEIKRDYILCTDVSDRINWISWK-----KTDIT 394

  Fly   303 FGSNYPSESRVFR-------EFS 318
            .|.:|..|...||       |||
  Fly   395 AGYSYACEVPEFRKKVTHLPEFS 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 58/263 (22%)
CG3819NP_001262027.1 NUC 164..415 CDD:238043 58/271 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.