DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and CG6839

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_649076.1 Gene:CG6839 / 40067 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster


Alignment Length:283 Identity:57/283 - (20%)
Similarity:90/283 - (31%) Gaps:79/283 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VTALCAS----FVGGMYFQHTDARKRLRELIQTDPYAYYLSPKIYEVFTFFESNNEDDHRMRQIM 76
            :||.|.|    .|||..|:..|                 |..|.:..|...:|....:..:  ::
  Fly   113 LTASCVSGTTFSVGGSNFEFKD-----------------LYCKSWPGFKAVKSGATCNGGI--VI 158

  Fly    77 KFGFPGLDDLRLYSDFVLSYDRRNRVAHWVCEHLQADSIHPNRGRR-----------GRN--PYQ 128
            :.||. :...|......:.::....|..:....|:..|.:...|..           |:|  ...
  Fly   159 RVGFE-ITSSRFAEQMQICFNEEEEVTRYTRHKLEPGSNYYETGVARITFQTAGFFDGKNVDKLY 222

  Fly   129 PDLSVPSNFRSELSDYRRSGFD--------RGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFN 185
            ...:......:||.......||        ||||.|..:....... ..||...|.||| .|.||
  Fly   223 TQATQLETINNELGGDAEKYFDSSSNVYLARGHLGAKADFDYAPEQ-RATFLFINAAPQ-WQTFN 285

  Fly   186 RSAWNNLEQYVRNLVHR-------FGSVFVCT---------GPLY--KPNQRPGGKWAVEYEMIG 232
            ...|..:|..:|..|.:       :..|:..|         .|||  |.:...|           
  Fly   286 AGNWARVEDGLRAWVSKNKLNVNCYTGVYGVTTLPNKDGVETPLYLAKDDNNNG----------- 339

  Fly   233 LNMVAVPTHFFKVIMVESKLHLG 255
              ::.||..:|:|: ::...|.|
  Fly   340 --LIPVPKLYFRVV-IDPSSHRG 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 44/221 (20%)
CG6839NP_649076.1 NUC 170..420 CDD:238043 41/206 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450450
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.