DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and CG14118

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_648612.1 Gene:CG14118 / 39465 FlyBaseID:FBgn0036323 Length:439 Species:Drosophila melanogaster


Alignment Length:247 Identity:58/247 - (23%)
Similarity:94/247 - (38%) Gaps:71/247 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 GLD--DLRLYSDFVLSYDRRNRVAHWVCEHLQADSIHPNRGRRGRNPYQPDLSVPSNFRSELSDY 144
            |.|  |.|..:...|.:|......|:....|...::|..:..:     :|..|...:|       
  Fly   174 GYDTGDGRFVATMELCHDPNQLRTHYAHHQLTPANVHFQKKLK-----RPRFSTAGHF------- 226

  Fly   145 RRSGFD----------------------------RGHLAAAGN--HHLQQNHCEDTFFLTNIAPQ 179
              :|||                            ||||.|..:  :..||   :.:|...|:|||
  Fly   227 --TGFDMARIYSPKSQEKLMVPGLIDVKSGLFLARGHLTAKADLIYASQQ---KSSFNYMNVAPQ 286

  Fly   180 VGQGFNRSAWNNLEQYVRNLVHRFG-SVFVCTGPLYKPNQRPGGK---WAVEYEMIGLNMVAVPT 240
             .|.||...|:.||:..|..|.|.| :..|.|| :|...:..|.|   .......||  :||||.
  Fly   287 -WQSFNGGQWSKLEESTRQYVARSGITATVYTG-IYGEMKVAGSKVLHMTTNANNIG--VVAVPQ 347

  Fly   241 HFFKVIMVE-------SKLHLGKPYM------EGYVLPNAPIPDGLPLRSFL 279
            .|::|::.|       :.:.:..|:.      |.|::.: |:.:.:...|:|
  Fly   348 LFYRVLIDEGHPTRGIALVGVNNPHATLAQIHESYIICD-PVEESVQWLSWL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 58/247 (23%)
CG14118NP_648612.1 NUC 175..428 CDD:238043 57/246 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450456
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.