DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and EndoG

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster


Alignment Length:311 Identity:145/311 - (46%)
Similarity:188/311 - (60%) Gaps:39/311 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GVTALCASFVGGMYF--------QHTDARKRLRELIQTDPYAYYLSPKIYEVFTF---------- 61
            ||.||.|:.:|..|.        ||..:...|              |::..:.||          
  Fly     8 GVLALGATALGAFYLGTHVERERQHNGSTSGL--------------PRLPGLPTFGTVSAASLIP 58

  Fly    62 FESNN----EDDHRMRQIMKFGFPGLDDLRLYSDFVLSYDRRNRVAHWVCEHLQADSIHPNRG-R 121
            .:.||    ....|:.||||:||||||.:|.:||:||||||||||.|||.|||.|:|:..|.. .
  Fly    59 AQENNVSLTATPSRIGQIMKYGFPGLDHVRSHSDYVLSYDRRNRVPHWVFEHLTAESVAKNDAVD 123

  Fly   122 RGRNPYQPDLSVPSNFRSELSDYRRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNR 186
            |.:..::.|.|:...|||:.:||||||:||||:||||||.|.|.||::||:|:|:||||||||||
  Fly   124 RSKCDFKQDESIHPFFRSQNTDYRRSGYDRGHMAAAGNHRLHQKHCDETFYLSNMAPQVGQGFNR 188

  Fly   187 SAWNNLEQYVRNLVHRFGSVFVCTGPLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFFKVIMVESK 251
            .|||.||.:||.|...:.:|:|||||||.|::...||..|:||:||.|.|||||||:|||:.||.
  Fly   189 DAWNTLEAHVRRLTKTYSNVYVCTGPLYLPHKEDDGKSYVKYEVIGANTVAVPTHFYKVIVGESA 253

  Fly   252 LHLGKPYMEGYVLPNAPIPDGLPLRSFLCDIREIEHYAGLKFFDGLRRSAL 302
            .|  |.:||.||:||..|.:..|:..|......:|..|||.|||.:.|..|
  Fly   254 DH--KLHMESYVMPNQVISNDTPISVFQVPPESVERSAGLLFFDQINRKQL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 127/226 (56%)
EndoGNP_610737.1 NUC1 39..305 CDD:224777 136/280 (49%)
NUC 77..309 CDD:238043 127/228 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448653
Domainoid 1 1.000 249 1.000 Domainoid score I2130
eggNOG 1 0.900 - - E1_COG1864
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 177 1.000 Inparanoid score I1145
Isobase 1 0.950 - 0 Normalized mean entropy S973
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 1 1.000 - - otm40477
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3743
1110.850

Return to query results.
Submit another query.