DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and Endog

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001030110.1 Gene:Endog / 362100 RGDID:1310763 Length:294 Species:Rattus norvegicus


Alignment Length:220 Identity:104/220 - (47%)
Similarity:143/220 - (65%) Gaps:4/220 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 QIMKFGFPGLDDLRLYSDFVLSYDRRNRVAHWVCEHLQADSIHPNRGRRGRNPYQPDLSVPSNFR 138
            ::.|:|.||:..||....:|||||.|.|.|.||.|.|:.:.:..:..||..:.::.| ||.:..|
  Rat    60 ELAKYGLPGVAQLRSRESYVLSYDPRTRGALWVLEQLRPERLRGDGDRRACDFHEDD-SVHAYHR 123

  Fly   139 SELSDYRRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQYVRNLVHRF 203
            :..:|||.|||||||||||.||...|...:|||:|:|:||||.. .|:.||||||:|.|:|...:
  Rat   124 ATNADYRGSGFDRGHLAAAANHRWSQRAMDDTFYLSNVAPQVPH-LNQHAWNNLEKYSRSLTRTY 187

  Fly   204 GSVFVCTGPLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFFKVIMVESKLHLGKPYMEGYVLPNAP 268
            .:|:||||||:.|.....||..|:|::||.|.||||||||||:::|:.  .|:..:..||:||||
  Rat   188 QNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAA--SGQIELRSYVMPNAP 250

  Fly   269 IPDGLPLRSFLCDIREIEHYAGLKF 293
            :.:.|||..||..|..||..:||.|
  Rat   251 VDETLPLERFLVPIESIERASGLLF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 104/220 (47%)
EndogNP_001030110.1 NUC 75..281 CDD:214683 98/205 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340550
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1864
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52002
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 1 1.000 - - otm44618
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3743
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.820

Return to query results.
Submit another query.