DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and CG12917

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_610558.2 Gene:CG12917 / 36065 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster


Alignment Length:158 Identity:33/158 - (20%)
Similarity:58/158 - (36%) Gaps:39/158 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 DRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQYVRNLVH-------RFGSVF 207
            :|||:.|:.: .|..:....||...|:.||. :..|...|..:|::||:.:.       :.|.:.
  Fly   206 NRGHMVASAD-FLFTDQMGSTFRYLNVVPQF-KSINDGNWEKIERWVRSQIPKSSYFRVKSGGIG 268

  Fly   208 VCTGPLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFFKVI------------MVESKLHLGKPYME 260
            :.|        .|..:..::...:..:.:.||...:|.:            ...|...:.||...
  Fly   269 ILT--------LPDTRGFLQSAFLAGSKIPVPEWTYKAVRDATGNGLYVFLTYNSTFQMEKPPCL 325

  Fly   261 GYVLP-NAPI------PDGLPLRSFLCD 281
            ....| |.||      .||.   :|.||
  Fly   326 AICYPVNCPIHLPNNPNDGY---TFCCD 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 33/158 (21%)
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 33/158 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.