DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and Exog

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:XP_006244150.2 Gene:Exog / 301062 RGDID:1304628 Length:443 Species:Rattus norvegicus


Alignment Length:227 Identity:87/227 - (38%)
Similarity:125/227 - (55%) Gaps:6/227 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KFGFP--GLDDLRLYSDFVLSYDRRNRVAHWVCEHLQADSIHPNRGRRGRNPYQPDLSVPSNFRS 139
            :||||  | .:.|.|::..||||:..||..||.||:..|.|..:..|: ...::||.:|||.|.:
  Rat   139 QFGFPLTG-TETRRYTNHALSYDQAKRVPRWVLEHISKDKIIGDADRK-HCKFKPDPTVPSAFSA 201

  Fly   140 ELSDYRRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQYVRNLVHRFG 204
            ...||..||:.|||:|.|||:........:||:|:||.||..:. |...||.:|.|.|.|..||.
  Rat   202 LNEDYIGSGWSRGHMAPAGNNKFSSEAMAETFYLSNIVPQNFEN-NSGYWNRIEMYCRELTERFE 265

  Fly   205 SVFVCTGPLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFFKVIMVESKLHLGKPYMEG-YVLPNAP 268
            .|::.:|||..|:.|..|...|.|::||.:.||||:|.:|||:........:|...| :|:||..
  Rat   266 DVWIVSGPLTLPHTRNDGTKTVSYQVIGEDNVAVPSHLYKVILARRSPESTEPLALGAFVVPNKA 330

  Fly   269 IPDGLPLRSFLCDIREIEHYAGLKFFDGLRRS 300
            |.....|..|...:.::|..:||.||..|.|:
  Rat   331 IGFQSQLSEFQVSLHDLEKMSGLVFFPHLDRT 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 86/225 (38%)
ExogXP_006244150.2 NUC 152..361 CDD:214683 80/210 (38%)
Exog_C 377..425 CDD:407864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.