DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and ENDOD1

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_055851.1 Gene:ENDOD1 / 23052 HGNCID:29129 Length:500 Species:Homo sapiens


Alignment Length:218 Identity:49/218 - (22%)
Similarity:74/218 - (33%) Gaps:63/218 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EDDHRMRQIMKFGFPGLDDLRLYSD--------------FVLSYDRRNRVAHWVCEHLQADSIHP 117
            |::....:..||.:.|.....|.:|              |...|..|:|:.  |....:|....|
Human    26 EEEAGFGECDKFFYAGTPPAGLAADSHVKICQRAEGAERFATLYSTRDRIP--VYSAFRAPRPAP 88

  Fly   118 NRGRRGRNPYQPDLSVP-SNFRSEL-------------------SDYRRSGFDRGHLAAAGNHHL 162
            . |...|...:|.:..| ||....:                   :||..|.:.||.|..   ..|
Human    89 G-GAEQRWLVEPQIDDPNSNLEEAINEAEAITSVNSLGSKQALNTDYLDSDYQRGQLYP---FSL 149

  Fly   163 QQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQYV-RNLVHRFGS---VFVCTGPL---YKPNQR- 219
            ..:....||.|||.||.. |.|....:.||...: |.|..:.||   :::.||.:   |:...: 
Human   150 SSDVQVATFTLTNSAPMT-QSFQERWYVNLHSLMDRALTPQCGSGEDLYILTGTVPSDYRVKDKV 213

  Fly   220 --------------PGGKWAVEY 228
                          |||.||:.:
Human   214 AVPEFVWLAACCAVPGGGWAMGF 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 48/211 (23%)
ENDOD1NP_055851.1 NUC 65..281 CDD:294067 43/179 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.