DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and Exog

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_766044.1 Gene:Exog / 208194 MGIID:2143333 Length:368 Species:Mus musculus


Alignment Length:298 Identity:104/298 - (34%)
Similarity:145/298 - (48%) Gaps:37/298 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GFVLG--VTALCASFVGGMYFQHTDAR--KRLRELIQTDPYAYYLSPKIYEVFTFFESNNEDDHR 71
            ||:.|  |.|..|......:|:..||.  |..|:     |:               ||..|    
Mouse    19 GFLAGAVVGAAGAGLTALQFFRRPDAESAKLARQ-----PH---------------ESAEE---- 59

  Fly    72 MRQIMKFGFP-GLDDLRLYSDFVLSYDRRNRVAHWVCEHLQADSIHPNRGRRGRNPYQPDLSVPS 135
             ..:.:|||| ...:.|.|::..||||:..||..||.||:..|.|..:..|: ...::||.||||
Mouse    60 -AVLEQFGFPLAGTETRRYTNHALSYDQAKRVPRWVLEHISKDKIIGDADRK-HCKFKPDPSVPS 122

  Fly   136 NFRSELSDYRRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGF--NRSAWNNLEQYVRN 198
            .|.:...||..||:.|||:|.|||:........:||:|:||.|   |.|  |...||.:|.|.|.
Mouse   123 AFSALNEDYIGSGWSRGHMAPAGNNKFSSEAMAETFYLSNIVP---QNFDNNSGYWNRIEMYCRE 184

  Fly   199 LVHRFGSVFVCTGPLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFFKVIMVESKLHLGKPYMEG-Y 262
            |..||..|::.:|||..|:.|..|...|.|::||.:.||||:|.:|||:........:|...| :
Mouse   185 LTERFEDVWIVSGPLTLPHTRNDGTKTVSYQVIGEDNVAVPSHLYKVILARRSPESTEPLALGAF 249

  Fly   263 VLPNAPIPDGLPLRSFLCDIREIEHYAGLKFFDGLRRS 300
            |:||..|.....|..|...:.::|..:||.||..|.||
Mouse   250 VVPNKAIGFQSQLSEFQVSLHDLEKMSGLVFFPRLDRS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 87/229 (38%)
ExogNP_766044.1 NUC 77..287 CDD:214683 82/213 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.