DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and ENDOG

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:XP_011516649.1 Gene:ENDOG / 2021 HGNCID:3346 Length:338 Species:Homo sapiens


Alignment Length:168 Identity:71/168 - (42%)
Similarity:98/168 - (58%) Gaps:17/168 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 QIMKFGFPGLDDLRLYSDFVLSYDRRNRVAHWVCEHLQADSIHPNRGRRGRNPYQPDLSVPSNFR 138
            ::.|:|.|||..|:....:||.||.|.|.|.||.|.|:.:.:..: |.|....::.|.||.:..|
Human   152 ELAKYGLPGLAQLKSRESYVLCYDPRTRGALWVVEQLRPERLRGD-GDRRECDFREDDSVHAYHR 215

  Fly   139 SELSDYRRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQYVRNLVHRF 203
            :..:|||.|||||||||||.||...|...:|||:|:|:||||.. .|::||||||:|.|:|...:
Human   216 ATNADYRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQVPH-LNQNAWNNLEKYSRSLTRSY 279

  Fly   204 GSVFVCTGPLYKPNQRPGGKWAVEYEMIGLNMVAVPTH 241
            .:|:||||||:.|.               |.|.:.|.|
Human   280 QNVYVCTGPLFLPR---------------LGMESRPHH 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 71/168 (42%)
ENDOGXP_011516649.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146896
Domainoid 1 1.000 249 1.000 Domainoid score I2130
eggNOG 1 0.900 - - E1_COG1864
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S973
OMA 1 1.010 - - QHG52002
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 1 1.000 - - otm40477
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.