DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and Endog

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_031957.1 Gene:Endog / 13804 MGIID:1261433 Length:294 Species:Mus musculus


Alignment Length:220 Identity:103/220 - (46%)
Similarity:143/220 - (65%) Gaps:4/220 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 QIMKFGFPGLDDLRLYSDFVLSYDRRNRVAHWVCEHLQADSIHPNRGRRGRNPYQPDLSVPSNFR 138
            ::.|:|.||:..||....:|||||.|.|.|.||.|.|:.:.:..: |.|....::.|.||.:..|
Mouse    60 ELAKYGLPGVAQLRSRESYVLSYDPRTRGALWVLEQLRPERLRGD-GDRSACDFREDDSVHAYHR 123

  Fly   139 SELSDYRRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQYVRNLVHRF 203
            :..:|||.|||||||||||.||...|...:|||:|:|:||||.. .|::||||||:|.|:|...:
Mouse   124 ATNADYRGSGFDRGHLAAAANHRWSQRAMDDTFYLSNVAPQVPH-LNQNAWNNLERYSRSLTRTY 187

  Fly   204 GSVFVCTGPLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFFKVIMVESKLHLGKPYMEGYVLPNAP 268
            .:|:||||||:.|.....||..|:|::||.|.||||||||||:::|:.  .|:..:..||:||||
Mouse   188 QNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAA--GGQIELRSYVMPNAP 250

  Fly   269 IPDGLPLRSFLCDIREIEHYAGLKF 293
            :.:.:||..||..|..||..:||.|
Mouse   251 VDETIPLERFLVPIESIERASGLLF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 103/220 (47%)
EndogNP_031957.1 NUC1 29..278 CDD:224777 103/220 (47%)
NUC 75..281 CDD:214683 97/205 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836842
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1864
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S973
OMA 1 1.010 - - QHG52002
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.760

Return to query results.
Submit another query.