DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and LOC105945145

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:XP_017948005.1 Gene:LOC105945145 / 105945145 -ID:- Length:332 Species:Xenopus tropicalis


Alignment Length:272 Identity:66/272 - (24%)
Similarity:106/272 - (38%) Gaps:79/272 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LCASFVGGMYFQHTDARKRLRELIQTDPYAYYL------SPKIYEVFTFFESNNEDDHRMRQIMK 77
            :|..:...:||.....|.|...|     |:.|:      |..|.:..|||  |.|.....||:  
 Frog    71 ICQKYGNRVYFASLYDRGRRVPL-----YSAYILDRRPTSKPINKRQTFF--NIEPQLIYRQL-- 126

  Fly    78 FGFPGLDDLRLYSDFVLSYDRR--NRVAHWVCEHLQADSIHPNRGRRGRNPYQPDLSVPSNFRSE 140
                         |..:..:|.  |.:..:..:|    :|.|   |..:|  ||. |:.:..::.
 Frog   127 -------------DGTMLPERNTSNNIKTFNTKH----NISP---REQKN--QPS-SLINTSQAV 168

  Fly   141 LSDYRRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQYVRNLVHRFGS 205
            .:|||.||:||||:...| ||:..:..:.||.|||:.| :.:..|...|:   ||..:::   ||
 Frog   169 DADYRNSGYDRGHVNPRG-HHVTDDEQKGTFTLTNVVP-MAKKLNNEFWS---QYENDMI---GS 225

  Fly   206 ------VFVCTGPLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFFKVIMVESKLHLGKPYMEGYVL 264
                  ::|.||.:      |..:|      |..:.|.:|.:.:.......|             
 Frog   226 AKGCKTMYVVTGIV------PSKEW------IKGDRVNIPKYMWNAYCCVGK------------- 265

  Fly   265 PNAPIPDGLPLR 276
            .:.||..|..||
 Frog   266 DDKPIKSGAGLR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 50/211 (24%)
LOC105945145XP_017948005.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.