DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and wu:fd46g04

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001373712.1 Gene:wu:fd46g04 / 103909050 ZFINID:ZDB-GENE-030131-4651 Length:272 Species:Danio rerio


Alignment Length:255 Identity:55/255 - (21%)
Similarity:92/255 - (36%) Gaps:74/255 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 NEDDHRMRQIMKFGFPGLDD----LRLYSDFVLSYDRRNRVAHWVCEHLQADSIHPNRGRRGRNP 126
            :|||::     ||.:..|..    :.:||.:....:...|...|..|. |.|         |.|.
Zfish    53 DEDDNK-----KFLYATLYSTTWKIPIYSAYWFGKESTGRCDVWYIEP-QLD---------GENE 102

  Fly   127 --YQPDLSVPSNFRSELSDYRRSGFDRGHLAAAGNHHLQQNHCE--DTFFLTNIAPQVGQGFNRS 187
              .:|..|...|.::..|||:.||:|:||:....:.:   ||..  .|..|||.|||..: ||:.
Zfish   103 PCMRPKGSKIKNNQAVSSDYKNSGYDKGHVYPVMHTY---NHLAMLATSTLTNAAPQKSK-FNKE 163

  Fly   188 AWNNLEQYVRNLVHRFGSVFVCTG-----PLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFFKV-- 245
            .|...|:.|...:......:|..|     ...|.|                |.:.|...|::.  
Zfish   164 DWKEHEKAVIKDLASCKKAYVVAGVAPDTTAAKVN----------------NKITVSKFFWRATC 212

  Fly   246 IMVESKLHLGKPY--------------------MEGY----VLPNAPIPDGLPLRSFLCD 281
            .:..:.:::||.|                    ::.|    :.|:.|....:|..:..|:
Zfish   213 CLNSNDVYIGKAYFGPNNNDKVEEKTVQELETLLKSYYEIKIFPSIPKKSKIPRNANPCN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 52/247 (21%)
wu:fd46g04NP_001373712.1 Endonuclease_NS 62..260 CDD:214889 47/227 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.