DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and LOC101886621

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:XP_017210191.1 Gene:LOC101886621 / 101886621 -ID:- Length:298 Species:Danio rerio


Alignment Length:261 Identity:75/261 - (28%)
Similarity:119/261 - (45%) Gaps:59/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PGLDDLRLYSDFVLSYDRRNRVAHWVCEHLQADSIHPNRGRRGRNPYQPDLSVPSNFRSELSDYR 145
            |....:|....:|:||:...:.|.||.|.|..|::           .:.|::     :.:.|||.
Zfish    51 PSKKKIRTKKSYVMSYNENTKNAEWVYEILNKDTL-----------AKKDIA-----KGKFSDYS 99

  Fly   146 R-SGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQYVRNLV-HRFGSVFV 208
            : :|:.|||||||.||...|...::||..:||:||..: .|:...|.||::.:..| .:..:|.|
Zfish   100 KVAGYTRGHLAAASNHGWCQEAYDETFLFSNISPQCAE-LNKHMMNALEKWCQETVTDQILNVHV 163

  Fly   209 CTGPLYKPN---QRPGGKWAVEYEMIGLNMVAVPTHFFKVIMVESKL-HLGKPYMEGYVLPN--- 266
            .|||:...|   ||......|           ||..|||||:.|::. .:.:|.  ||::.|   
Zfish   164 YTGPIITANSAIQRRNASEKV-----------VPDSFFKVIIKENRNGTVSEPI--GYLITNDET 215

  Fly   267 -------APIPDGLPLRSFL-----CDIREIEHYAGLKFFD-GLR------RSALF-GSNYPSES 311
                   ..:...:|:..|:     ..:|:||..:||||.: .:|      ||..: |.|...||
Zfish   216 TLVKDAEDKVKHAMPIDEFVQTKYKKSVRDIESISGLKFCETNVRVVNEENRSVTWTGENAKGES 280

  Fly   312 R 312
            |
Zfish   281 R 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 68/246 (28%)
LOC101886621XP_017210191.1 Endonuclease_NS 51..255 CDD:307400 66/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.