DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and LOC101885869

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:XP_005159398.1 Gene:LOC101885869 / 101885869 -ID:- Length:368 Species:Danio rerio


Alignment Length:285 Identity:62/285 - (21%)
Similarity:106/285 - (37%) Gaps:84/285 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VLGVTALCASFVGGMYFQHTDARKRLRELIQTDPYAY---YLSPKIYEVFT----FF-------- 62
            ::|.....::....::..|...:.::|..:.:....:   ::..::.:.|:    ||        
Zfish    68 IVGAFYSISTTTSALFLTHDSLQLKMRRSVVSALLVFSFPFIITEVVDSFSKCSQFFLEGKPPVI 132

  Fly    63 -----ESNNEDDHRMRQIMKFGFPGLDDLRLYSD---FVLSYDRRNRV----------------- 102
                 :|.::|::|.:.|          .:.|.:   |...||..|::                 
Zfish   133 PGILKDSVSQDNNRYKLI----------CQRYKNAYRFATLYDTTNKIPVFSAYRYTGFKKGRPQ 187

  Fly   103 AHWVCE-HLQADSIHPNRGRRGRNPYQPDLSVPSNFRSELSDYRRSGFDRGHLAAAGNHHLQQNH 166
            ..|:.| .|:...:. .|.||....|..|..         ..||   .|||||...| |...::.
Zfish   188 IRWMIEPQLETSGVQ-MRARRVNQAYTEDYQ---------KLYR---LDRGHLFPNG-HAANKDI 238

  Fly   167 CEDTFFLTNIAPQVGQGFNRSAWNNLEQYVRNLVH----RFGSVFVCTGPLYKPNQRPGGKWAVE 227
            .|.||.|||:.||. :.||..:||.:|..||.|:.    :....:|.||.:  |||.       .
Zfish   239 AESTFTLTNVVPQY-KSFNGGSWNRMENDVRELMDSDCAKNRPAYVLTGAV--PNQE-------H 293

  Fly   228 YEMIGLNM-VAVPTHFFKVIMVESK 251
            |    ||. |.:|||.:......:|
Zfish   294 Y----LNQKVNIPTHMWNAFCCYNK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 53/204 (26%)
LOC101885869XP_005159398.1 Endonuclease_NS 158..328 CDD:214889 51/185 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.