DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and LOC100490758

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:XP_002932761.1 Gene:LOC100490758 / 100490758 -ID:- Length:306 Species:Xenopus tropicalis


Alignment Length:284 Identity:65/284 - (22%)
Similarity:97/284 - (34%) Gaps:92/284 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AYYLSPKIYEVFT----FFES--------NNEDDHRMRQIMKFGFPGLDD-------------LR 87
            |:...|.|.|.||    ||.:        |....|.:..      |.|.|             .:
 Frog    15 AHKAEPFISENFTECREFFYNQSFPQGFQNISPPHHINH------PNLPDGIKAKELTSPAYICQ 73

  Fly    88 LYSD---FVLSYDRRNRV---AHWVCEHLQADSIHPNRGRRGRNPYQPDL--------------- 131
            .|.:   |...|||..||   :.::.:....|...|  ||:.|...:|.|               
 Frog    74 RYKNIDYFASLYDRGRRVPLYSAYILDRRPTDKCIP--GRQTRFNVEPQLVDRKLNKAMLSQSAT 136

  Fly   132 --SVPSNFR---------------SELSDYRRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQ 179
              .:..:|:               :..:||..:|:.||||... .||..|...:.||.|||..| 
 Frog   137 KGEIQKHFKIKNIQEALERLRTSQAVSADYGITGYHRGHLNPV-CHHKNQVAQDATFTLTNAVP- 199

  Fly   180 VGQGFNRSAWNNLEQYVRNLVHRFGSVFVCTGPLYKPNQRPGGKWAVEYEMIGLN-MVAVPTHFF 243
            :....|:..||..|:.:..:.....:.:|.||.:      ||..        .|| .|.:|:|.:
 Frog   200 MNSSLNQGQWNVYEKKMIEIARDCNTTYVVTGIV------PGNN--------SLNDRVNIPSHVW 250

  Fly   244 KV-IMVESKLHLGKPYMEGYVLPN 266
            .. ..|::.   |||...|..|.|
 Frog   251 SAYCCVDNN---GKPIRSGAGLAN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 55/246 (22%)
LOC100490758XP_002932761.1 Endonuclease_NS 79..295 CDD:214889 51/214 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.